Clone BO29022 Report

Search the DGRC for BO29022

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG42704-RA
Protein status:BO29022.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO29022.complete Sequence

391 bp assembled on 2011-09-14

GenBank Submission: KX793854

> BO29022.complete
GAAGTTATCAGTCGACATGAAAATTACCATTGCAATTCTAGGACTTTTTC
TGGCACTTATTTGCAGCCTGGAATCGCCAACCGCAGCGTGCGATATCCAA
GCAGTTTATAATCAAACCTTAAAGTTCTGCGAAAACAACTTCTTTCTGAA
CATATTCTTGTGCACCGGCTTGTCTTACGGTGTCGGCAACGAGAAATTTG
TTCAGACGCTCCAGTCGCAAAGGAAGATCTTGTGTGCAATACCATTTTTT
GCTGAAATTTGCAAAACCTGCGATTTTTCGACGATTGTCTCAAATGATCA
GAATGCTACGATTTCAAGCGGAAATTCAACTGCAGACGCCACCCGAACTT
TGAAGCTTGCCGATCTGACGCGTGCAAGCTTTCTAGACCAT

BO29022.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-RA 360 CG42704-PA 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-RA 501 CG42704-RA 20..376 17..373 1785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7412973..7413171 175..373 980 99.5 Plus
X 23542271 X 7412816..7412907 88..179 460 100 Plus
X 23542271 X 7412687..7412758 17..88 360 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:23:14 has no hits.

BO29022.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:00:03 Download gff for BO29022.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..376 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:44 Download gff for BO29022.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..376 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:36 Download gff for BO29022.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..376 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:36 Download gff for BO29022.complete
Subject Subject Range Query Range Percent Splice Strand
X 7412687..7412758 17..88 100 -> Plus
X 7412817..7412906 89..178 100 -> Plus
X 7412977..7413171 179..375 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:44 Download gff for BO29022.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7306720..7306791 17..88 100 -> Plus
arm_X 7306850..7306939 89..178 100 -> Plus
arm_X 7307010..7307204 179..375 98   Plus

BO29022.pep Sequence

Translation from 16 to 391

> BO29022.pep
MKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFLNIFLCT
GLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSNDQNATIS
SGNSTADATRTLKLADLTRASFLDH

BO29022.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-PA 119 CG42704-PA 1..119 1..119 609 100 Plus