Clone BO29049 Report

Search the DGRC for BO29049

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG42615-RB
Protein status:BO29049.pep: Imported from assembly
Sequenced Size:235

Clone Sequence Records

BO29049.complete Sequence

235 bp assembled on 2011-08-24

GenBank Submission: KX800130

> BO29049.complete
GAAGTTATCAGTCGACATGGACCACAAGAAAACGTTAACCTGGTTTTTCA
GCCTGTCATCGGTGCGCTACGCGCAGATCTTTATCGTAATGGCGGTCGAT
CTGCTGACCCTGTCCAATCTGTATCCCAAGCACTCGAGCTACATTGCGCG
TCCATTCCTACTCTGGCAGGATCTTCAGGAGGAGGACGAACGTAGCTTGG
ACTCACCCCAGCAATTCGCAAGCTTTCTAGACCAT

BO29049.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-RB 204 CG42615-PB 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-RB 421 CG42615-RB 58..258 17..217 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8737427..8737627 17..217 1005 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:51:19 has no hits.

BO29049.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:47 Download gff for BO29049.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..258 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:33 Download gff for BO29049.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..258 17..219 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:11 Download gff for BO29049.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 58..258 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:11 Download gff for BO29049.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8737427..8737627 17..219 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:33 Download gff for BO29049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4624932..4625132 17..219 99   Plus

BO29049.pep Sequence

Translation from 16 to 235

> BO29049.pep
MDHKKTLTWFFSLSSVRYAQIFIVMAVDLLTLSNLYPKHSSYIARPFLLW
QDLQEEDERSLDSPQQFASFLDH

BO29049.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-PB 67 CG42615-PB 1..67 1..67 349 100 Plus