BO29049.complete Sequence
235 bp assembled on 2011-08-24
GenBank Submission: KX800130
> BO29049.complete
GAAGTTATCAGTCGACATGGACCACAAGAAAACGTTAACCTGGTTTTTCA
GCCTGTCATCGGTGCGCTACGCGCAGATCTTTATCGTAATGGCGGTCGAT
CTGCTGACCCTGTCCAATCTGTATCCCAAGCACTCGAGCTACATTGCGCG
TCCATTCCTACTCTGGCAGGATCTTCAGGAGGAGGACGAACGTAGCTTGG
ACTCACCCCAGCAATTCGCAAGCTTTCTAGACCAT
BO29049.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:51:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42615-RB | 204 | CG42615-PB | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:51:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42615-RB | 421 | CG42615-RB | 58..258 | 17..217 | 1005 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:51:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8737427..8737627 | 17..217 | 1005 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 06:51:19 has no hits.
BO29049.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:47 Download gff for
BO29049.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42615-RB | 58..258 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:33 Download gff for
BO29049.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42615-RB | 58..258 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:11 Download gff for
BO29049.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42615-RB | 58..258 | 17..219 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:11 Download gff for
BO29049.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8737427..8737627 | 17..219 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:33 Download gff for
BO29049.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4624932..4625132 | 17..219 | 99 | | Plus |
BO29049.pep Sequence
Translation from 16 to 235
> BO29049.pep
MDHKKTLTWFFSLSSVRYAQIFIVMAVDLLTLSNLYPKHSSYIARPFLLW
QDLQEEDERSLDSPQQFASFLDH
BO29049.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42615-PB | 67 | CG42615-PB | 1..67 | 1..67 | 349 | 100 | Plus |