Clone BO29051 Report

Search the DGRC for BO29051

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG43109-RA
Protein status:BO29051.pep: Imported from assembly
Sequenced Size:205

Clone Sequence Records

BO29051.complete Sequence

205 bp assembled on 2011-08-24

GenBank Submission: KX797227

> BO29051.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTGGTTTATTCTCCACCTAATTG
GCCTCATCCAAGGGCGTTCTGTGGGCGGTGGGTCTGTAAACTTGGATGAC
GAGTTTTTCATGCCTCAGCCAGATCCCACAATATTTGCCTACAATCAAAC
TGATAAGGGATCATCACCCTGGGACAATACCTGGAACGCAAGCTTTCTAG
ACCAT

BO29051.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-RA 174 CG43109-PA 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-RA 261 CG43109-RA 15..185 17..187 855 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18868067..18868153 103..17 435 100 Minus
2R 25286936 2R 18867924..18868009 187..102 430 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:51:40 has no hits.

BO29051.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:48 Download gff for BO29051.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..185 17..189 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:46 Download gff for BO29051.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..185 17..189 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:22 Download gff for BO29051.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 15..185 17..189 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:22 Download gff for BO29051.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867921..18868007 104..189 97 <- Minus
2R 18868067..18868153 17..103 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:46 Download gff for BO29051.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14755426..14755512 104..189 97 <- Minus
arm_2R 14755572..14755658 17..103 100   Minus

BO29051.pep Sequence

Translation from 16 to 205

> BO29051.pep
MWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTDKGSS
PWDNTWNASFLDH

BO29051.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-PA 57 CG43109-PA 1..57 1..57 324 100 Plus