Clone BO29085 Report

Search the DGRC for BO29085

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG42688-RA
Protein status:BO29085.pep: Imported from assembly
Sequenced Size:184

Clone Sequence Records

BO29085.complete Sequence

184 bp assembled on 2011-08-24

GenBank Submission: KX794441

> BO29085.complete
GAAGTTATCAGTCGACATGTGCTGCAATCCTGGAGGCTGCTGCAACCTGC
CCTCCTGCATCCAGTGCACCAACTTTTGTTTCAACTGCTGGACGGGAACT
GCTGCAGTGCCATGTTGCCGAGGTAGTTGCATTCCGGGATGCAGTAGCAG
CCCTGGATGCCGTTGCGCAAGCTTTCTAGACCAT

BO29085.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 153 CG42688-PB 1..150 17..166 750 100 Plus
CG42688-RA 153 CG42688-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 785 CG42688-RB 345..494 17..166 750 100 Plus
CG42688-RA 397 CG42688-RA 183..332 17..166 750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19182256..19182405 166..17 750 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:30:10 has no hits.

BO29085.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:31 Download gff for BO29085.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 194..343 17..168 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:31 Download gff for BO29085.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 183..332 17..168 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:40 Download gff for BO29085.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 183..332 17..168 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:40 Download gff for BO29085.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19182253..19182405 17..168 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:31 Download gff for BO29085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19182253..19182405 17..168 98   Minus

BO29085.pep Sequence

Translation from 16 to 184

> BO29085.pep
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
ASFLDH

BO29085.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-PB 50 CG42688-PB 1..50 1..50 323 100 Plus
CG42688-PA 50 CG42688-PA 1..50 1..50 323 100 Plus