BO29085.complete Sequence
184 bp assembled on 2011-08-24
GenBank Submission: KX794441
> BO29085.complete
GAAGTTATCAGTCGACATGTGCTGCAATCCTGGAGGCTGCTGCAACCTGC
CCTCCTGCATCCAGTGCACCAACTTTTGTTTCAACTGCTGGACGGGAACT
GCTGCAGTGCCATGTTGCCGAGGTAGTTGCATTCCGGGATGCAGTAGCAG
CCCTGGATGCCGTTGCGCAAGCTTTCTAGACCAT
BO29085.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:30:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-RB | 153 | CG42688-PB | 1..150 | 17..166 | 750 | 100 | Plus |
CG42688-RA | 153 | CG42688-PA | 1..150 | 17..166 | 750 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:30:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-RB | 785 | CG42688-RB | 345..494 | 17..166 | 750 | 100 | Plus |
CG42688-RA | 397 | CG42688-RA | 183..332 | 17..166 | 750 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:30:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19182256..19182405 | 166..17 | 750 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:30:10 has no hits.
BO29085.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:31 Download gff for
BO29085.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 194..343 | 17..168 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:31 Download gff for
BO29085.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 183..332 | 17..168 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:40 Download gff for
BO29085.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42688-RA | 183..332 | 17..168 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:40 Download gff for
BO29085.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19182253..19182405 | 17..168 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:31 Download gff for
BO29085.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19182253..19182405 | 17..168 | 98 | | Minus |
BO29085.pep Sequence
Translation from 16 to 184
> BO29085.pep
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
ASFLDH
BO29085.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42688-PB | 50 | CG42688-PB | 1..50 | 1..50 | 323 | 100 | Plus |
CG42688-PA | 50 | CG42688-PA | 1..50 | 1..50 | 323 | 100 | Plus |