BO29124.complete Sequence
277 bp assembled on 2012-04-24
GenBank Submission: KX798065
> BO29124.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGGCAAGCTTTCTAGACCAT
BO29124.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:44:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RD | 252 | CG2986-PD | 1..243 | 17..259 | 1215 | 100 | Plus |
RpS21-RE | 246 | CG2986-PE | 1..243 | 17..259 | 1215 | 100 | Plus |
RpS21-RB | 252 | CG2986-PB | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:44:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RD | 415 | CG2986-RD | 99..341 | 17..259 | 1215 | 100 | Plus |
RpS21-RE | 494 | CG2986-RE | 116..358 | 17..259 | 1215 | 100 | Plus |
RpS21-RB | 619 | CG2986-RB | 75..317 | 17..259 | 1215 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:44:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2856376..2856569 | 66..259 | 970 | 100 | Plus |
2L | 23513712 | 2L | 2856256..2856305 | 17..66 | 250 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:44:01 has no hits.
BO29124.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:30 Download gff for
BO29124.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
oho23B-RB | 116..358 | 17..261 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:47 Download gff for
BO29124.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RB | 75..317 | 17..261 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:56:02 Download gff for
BO29124.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RB | 75..317 | 17..261 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:56:02 Download gff for
BO29124.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2856377..2856569 | 67..261 | 98 | | Plus |
2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:47 Download gff for
BO29124.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
arm_2L | 2856377..2856569 | 67..261 | 98 | | Plus |
BO29124.pep Sequence
Translation from 16 to 277
> BO29124.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITKASFLDH
BO29124.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-PE | 81 | CG2986-PE | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PD | 83 | CG2986-PD | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PB | 83 | CG2986-PB | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PA | 83 | CG2986-PA | 1..81 | 1..81 | 420 | 100 | Plus |
RpS21-PF | 83 | CG2986-PF | 1..81 | 1..81 | 420 | 100 | Plus |