Clone BO29124 Report

Search the DGRC for BO29124

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:24
Vector:pDNR-Dual
Associated Gene/Transcriptoho23B-RE
Protein status:BO29124.pep: Imported from assembly
Sequenced Size:277

Clone Sequence Records

BO29124.complete Sequence

277 bp assembled on 2012-04-24

GenBank Submission: KX798065

> BO29124.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGGCAAGCTTTCTAGACCAT

BO29124.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RD 252 CG2986-PD 1..243 17..259 1215 100 Plus
RpS21-RE 246 CG2986-PE 1..243 17..259 1215 100 Plus
RpS21-RB 252 CG2986-PB 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RD 415 CG2986-RD 99..341 17..259 1215 100 Plus
RpS21-RE 494 CG2986-RE 116..358 17..259 1215 100 Plus
RpS21-RB 619 CG2986-RB 75..317 17..259 1215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2856376..2856569 66..259 970 100 Plus
2L 23513712 2L 2856256..2856305 17..66 250 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:44:01 has no hits.

BO29124.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:30 Download gff for BO29124.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RB 116..358 17..261 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:47 Download gff for BO29124.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RB 75..317 17..261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:56:02 Download gff for BO29124.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RB 75..317 17..261 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:56:02 Download gff for BO29124.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856569 67..261 98   Plus
2L 2856256..2856305 17..66 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:47 Download gff for BO29124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2856256..2856305 17..66 100 -> Plus
arm_2L 2856377..2856569 67..261 98   Plus

BO29124.pep Sequence

Translation from 16 to 277

> BO29124.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITKASFLDH

BO29124.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-PE 81 CG2986-PE 1..81 1..81 420 100 Plus
RpS21-PD 83 CG2986-PD 1..81 1..81 420 100 Plus
RpS21-PB 83 CG2986-PB 1..81 1..81 420 100 Plus
RpS21-PA 83 CG2986-PA 1..81 1..81 420 100 Plus
RpS21-PF 83 CG2986-PF 1..81 1..81 420 100 Plus