Clone BO29171 Report

Search the DGRC for BO29171

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:71
Vector:pDNR-Dual
Associated Gene/Transcriptglob1-RE
Protein status:BO29171.pep: Imported from assembly
Sequenced Size:235

Clone Sequence Records

BO29171.complete Sequence

235 bp assembled on 2011-08-26

GenBank Submission: KX796252

> BO29171.complete
GAAGTTATCAGTCGACATGAACAGCGATGAGGTGCAACTGATCAAGAAGA
CCTGGGAAATCCCCGTGGCAACACCAACAGATTCTGGAGCGGCGATACTG
ACGCAGTTTTTCAACCGCTTTCCGTCCAACTTGGAGAAGTTCCCCTTCCG
CGATGTTCCTTTGGAGGAGCTAAGTGTGAGTTGTACCTTACACATAGGTC
TTCAATTAACTCAAGATGCAAGCTTTCTAGACCAT

BO29171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RE 204 CG9734-PE 1..201 17..217 1005 100 Plus
glob1-RF 462 CG9734-PF 1..160 17..176 800 100 Plus
glob1-RD 462 CG9734-PD 1..160 17..176 800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-RE 1021 CG9734-RE 141..343 15..217 1015 100 Plus
glob1-RF 921 CG9734-RF 101..262 15..176 810 100 Plus
glob1-RD 1143 CG9734-RD 323..484 15..176 810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15897733..15897935 217..15 1015 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:47:07 has no hits.

BO29171.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:48 Download gff for BO29171.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 145..345 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:56 Download gff for BO29171.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 145..345 17..219 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:29 Download gff for BO29171.complete
Subject Subject Range Query Range Percent Splice Strand
glob1-RE 143..343 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:29 Download gff for BO29171.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15897731..15897933 17..219 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:56 Download gff for BO29171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11723453..11723655 17..219 99   Minus

BO29171.pep Sequence

Translation from 16 to 235

> BO29171.pep
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLE
ELSVSCTLHIGLQLTQDASFLDH

BO29171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
glob1-PE 67 CG9734-PE 1..67 1..67 348 100 Plus
glob1-PF 153 CG9734-PF 1..53 1..53 275 100 Plus
glob1-PD 153 CG9734-PD 1..53 1..53 275 100 Plus
glob1-PA 153 CG9734-PA 1..53 1..53 275 100 Plus
glob1-PB 153 CG9734-PB 1..53 1..53 275 100 Plus