Clone BO29181 Report

Search the DGRC for BO29181

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG42508-RA
Protein status:BO29181.pep: Imported from assembly
Sequenced Size:373

Clone Sequence Records

BO29181.complete Sequence

373 bp assembled on 2011-08-26

GenBank Submission: KX799662

> BO29181.complete
GAAGTTATCAGTCGACATGGTCGGTCCATTCATGCAGGGCCTATTCTTGA
TTGGCATCATCTACTGGTATTCCAAGGGGATGATGTCCATGATCAACGAC
TACTACAGAAGTGAGTTCCAGCGAAAGTTGCAGACGGAACCAGCAAAGAC
GAGGGCAGAGACACCCATCAATGTGGACAACTTTATGGATTATGTTAGGG
AGCTGGACACTCCGGACGAGGTGGCTAGAATTCCGGCGGAAGGAACTGAA
TCTCCGCCCATGGGAAACACCTATTGCCACATCCTTCGACGATTCTTGGA
GATTACCGGCACTCTACCACCATTCGATGTTTGCCTAGTTACGAGCAACA
TAAGAGCAAGCTTTCTAGACCAT

BO29181.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 342 CG42508-PB 1..339 17..355 1695 100 Plus
CG42508-RA 342 CG42508-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RB 1029 CG42508-RB 525..863 17..355 1695 100 Plus
CG42508-RA 949 CG42508-RA 521..859 17..355 1695 100 Plus
Xport-RA 949 CG4468-RA 521..859 17..355 1695 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19914486..19914824 355..17 1695 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:48:13 has no hits.

BO29181.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:50 Download gff for BO29181.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 518..856 17..357 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:34:34 Download gff for BO29181.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RB 503..841 17..357 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:10:06 Download gff for BO29181.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 521..859 17..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:10:06 Download gff for BO29181.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914482..19914824 17..357 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:34:34 Download gff for BO29181.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15740204..15740546 17..357 99   Minus

BO29181.pep Sequence

Translation from 16 to 373

> BO29181.pep
MVGPFMQGLFLIGIIYWYSKGMMSMINDYYRSEFQRKLQTEPAKTRAETP
INVDNFMDYVRELDTPDEVARIPAEGTESPPMGNTYCHILRRFLEITGTL
PPFDVCLVTSNIRASFLDH

BO29181.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-PB 113 CG42508-PB 1..113 1..113 604 100 Plus
CG42508-PA 113 CG42508-PA 1..113 1..113 604 100 Plus