Clone BO29307 Report

Search the DGRC for BO29307

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:293
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG31777-RA
Protein status:BO29307.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO29307.complete Sequence

361 bp assembled on 2012-04-24

GenBank Submission: KX798165

> BO29307.complete
GAAGTTATCAGTCGACATGTCTCGACACAAGCCCGCGTCGGTGGTGCTAA
CGCTGCTGTTGGTGGTGCTGTTGGCGCTGATCCACCACCGCCGCATAGAT
GCCAGATTCGTGCCCGGTCCGCCTTCAATACCCAGTATTTGCAAAAAACC
ACCGCCACGTTCGGAGGGCGTTTGTGCCATTGATATCGAGGGATACTATT
ACGATCCGATAACATTTGACTGCAAGATGTACAAGATCGGGGCATGCCAC
TTGATTCGTGGCCAGAGTTTCGGCAGTCAACAGGATTGCATTTCCACCTG
CATCCATGGGATACGCCGGAATCATGACTTTTATGTGAACGAGGCAAGCT
TTCTAGACCAT

BO29307.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-RA 330 CG31777-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-RA 383 CG31777-RA 17..351 9..343 1645 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3706583..3706791 343..135 1045 100 Minus
2L 23513712 2L 3706920..3707047 136..9 610 98.4 Minus
Blast to na_te.dros performed 2014-11-28 04:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6893 83..37 127 74.5 Minus

BO29307.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:33 Download gff for BO29307.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 22..348 17..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:56 Download gff for BO29307.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 25..351 17..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:56:15 Download gff for BO29307.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 25..351 17..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:56:15 Download gff for BO29307.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3706922..3707039 17..134 100   Minus
2L 3706581..3706791 135..345 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:56 Download gff for BO29307.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3706581..3706791 135..345 99 <- Minus
arm_2L 3706922..3707039 17..134 100   Minus

BO29307.pep Sequence

Translation from 16 to 361

> BO29307.pep
MSRHKPASVVLTLLLVVLLALIHHRRIDARFVPGPPSIPSICKKPPPRSE
GVCAIDIEGYYYDPITFDCKMYKIGACHLIRGQSFGSQQDCISTCIHGIR
RNHDFYVNEASFLDH

BO29307.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-PA 109 CG31777-PA 1..109 1..109 594 100 Plus