BO29502.complete Sequence
280 bp assembled on 2011-08-31
GenBank Submission: KX799532
> BO29502.complete
GAAGTTATCAGTCGACATGAGATCGTTTTGTGTGTCTGTCTTATTAGTTA
CCCTTTTGGGGATTGCGATGGCATATAGAGATTATTCGGAGAAGTGCTAT
CAATCCCCTCGGTCTTATGGACCTTGTAATGTTAAGGCCCATGGATACAC
TTATGATTCTCGTAGAAATGTATGTCGTCGAATTGTTCTTCGGTGTATGG
CAAGGGGTAACTATTTCTTTGACAAAGATTCCTGCGAATACACATGCTTA
AAGCATATTCAGGCAAGCTTTCTAGACCAT
BO29502.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42467-RA | 249 | CG42467-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42467-RA | 361 | CG42467-RA | 18..263 | 17..262 | 1230 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:31:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 3701423..3701601 | 84..262 | 895 | 100 | Plus |
| 2L | 23513712 | 2L | 3701307..3701373 | 17..83 | 335 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 01:31:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 289..352 | 65..3 | 110 | 65.6 | Minus |
| Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 3069..3132 | 65..3 | 110 | 65.6 | Minus |
BO29502.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:14:05 Download gff for
BO29502.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42467-RA | 1..246 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:55:51 Download gff for
BO29502.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42467-RA | 18..263 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:04 Download gff for
BO29502.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42467-RA | 18..263 | 17..264 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:04 Download gff for
BO29502.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 3701423..3701601 | 84..264 | 98 | | Plus |
| 2L | 3701307..3701373 | 17..83 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:55:51 Download gff for
BO29502.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 3701423..3701601 | 84..264 | 98 | | Plus |
| arm_2L | 3701307..3701373 | 17..83 | 100 | -> | Plus |
BO29502.pep Sequence
Translation from 16 to 280
> BO29502.pep
MRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGYTYDSRR
NVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQASFLDH
BO29502.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42467-PA | 82 | CG42467-PA | 1..82 | 1..82 | 452 | 100 | Plus |
| Sfp24C1-PA | 80 | CG42466-PA | 1..78 | 1..81 | 143 | 40.7 | Plus |
