BO29804.complete Sequence
280 bp assembled on 2011-08-31
GenBank Submission: KX797665
> BO29804.complete
GAAGTTATCAGTCGACATGAGCGATGCCTCCCTGGAACTTCCCTCTGAAC
TATTGAACAAATCTCTAGTGACGGTCACCAATATCTCAAAGTCGTTGTCT
CGCCTGATTTTGAACTCCGCTCGCCGCTACTCCCGCTTCGTGCTCTTCTT
TAAGCCAGTTTTCGGAGATGCCCTGGTGGTCAAGGGATCTGAAGATCCCA
CTACAACCACCACAGTACGCACCACCACAACCACCGAAGAGACTGACAAG
CTCAACGAAGTCGCAAGCTTTCTAGACCAT
BO29804.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43386-RB | 462 | CG43386-PB | 213..459 | 16..262 | 1220 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43386-RB | 716 | CG43386-RB | 371..617 | 16..262 | 1220 | 99.6 | Plus |
CG1889-RA | 1468 | CG1889-RA | 1223..1373 | 262..112 | 740 | 99.3 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:28:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9966714..9966864 | 262..112 | 740 | 99.3 | Minus |
X | 23542271 | X | 9967024..9967120 | 112..16 | 485 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 01:28:51 has no hits.
BO29804.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:14:01 Download gff for
BO29804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15250-RA | 1..246 | 17..264 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:58 Download gff for
BO29804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43386-RB | 372..617 | 17..264 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:26:24 Download gff for
BO29804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43386-RB | 372..617 | 17..264 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:26:24 Download gff for
BO29804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9966712..9966863 | 113..264 | 98 | <- | Minus |
X | 9967024..9967119 | 17..112 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:58 Download gff for
BO29804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9860745..9860896 | 113..264 | 98 | <- | Minus |
arm_X | 9861057..9861152 | 17..112 | 100 | | Minus |
BO29804.pep Sequence
Translation from 16 to 280
> BO29804.pep
MSDASLELPSELLNKSLVTVTNISKSLSRLILNSARRYSRFVLFFKPVFG
DALVVKGSEDPTTTTTVRTTTTTEETDKLNEVASFLDH
BO29804.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43386-PB | 153 | CG15250-PA | 72..153 | 1..82 | 398 | 100 | Plus |