Clone BO29804 Report

Search the DGRC for BO29804

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:298
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG15250-RA
Protein status:BO29804.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO29804.complete Sequence

280 bp assembled on 2011-08-31

GenBank Submission: KX797665

> BO29804.complete
GAAGTTATCAGTCGACATGAGCGATGCCTCCCTGGAACTTCCCTCTGAAC
TATTGAACAAATCTCTAGTGACGGTCACCAATATCTCAAAGTCGTTGTCT
CGCCTGATTTTGAACTCCGCTCGCCGCTACTCCCGCTTCGTGCTCTTCTT
TAAGCCAGTTTTCGGAGATGCCCTGGTGGTCAAGGGATCTGAAGATCCCA
CTACAACCACCACAGTACGCACCACCACAACCACCGAAGAGACTGACAAG
CTCAACGAAGTCGCAAGCTTTCTAGACCAT

BO29804.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43386-RB 462 CG43386-PB 213..459 16..262 1220 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43386-RB 716 CG43386-RB 371..617 16..262 1220 99.6 Plus
CG1889-RA 1468 CG1889-RA 1223..1373 262..112 740 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9966714..9966864 262..112 740 99.3 Minus
X 23542271 X 9967024..9967120 112..16 485 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:28:51 has no hits.

BO29804.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 16:14:01 Download gff for BO29804.complete
Subject Subject Range Query Range Percent Splice Strand
CG15250-RA 1..246 17..264 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:58 Download gff for BO29804.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 372..617 17..264 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:26:24 Download gff for BO29804.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 372..617 17..264 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:26:24 Download gff for BO29804.complete
Subject Subject Range Query Range Percent Splice Strand
X 9966712..9966863 113..264 98 <- Minus
X 9967024..9967119 17..112 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:58 Download gff for BO29804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9860745..9860896 113..264 98 <- Minus
arm_X 9861057..9861152 17..112 100   Minus

BO29804.pep Sequence

Translation from 16 to 280

> BO29804.pep
MSDASLELPSELLNKSLVTVTNISKSLSRLILNSARRYSRFVLFFKPVFG
DALVVKGSEDPTTTTTVRTTTTTEETDKLNEVASFLDH

BO29804.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43386-PB 153 CG15250-PA 72..153 1..82 398 100 Plus