Clone BO29915 Report

Search the DGRC for BO29915

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:299
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG32856-RA
Protein status:BO29915.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO29915.complete Sequence

355 bp assembled on 2012-04-24

GenBank Submission: KX798307

> BO29915.complete
GAAGTTATCAGTCGACATGCTGCAAACAAATCGAGTCCTTCAAAAAGAGC
AGGCTGAACTATTTGCTATCCAGAAGAAACTCGACCGAGTGCTCCCCGTC
ATTCAGGAGGCATTAAATTCACTAAAGGTAGAGGAGCTGCATCTCAAGTC
TCAGGTGGTGGGCCAGCAGAACCCAAAAACGCAGTGCTCCCCTGGAAGGG
ATCCCCTCCACATAGATCTGTCGGTGGAGCAGTCCCCAATCACAACTGTG
ATGGAGTCCCATCTCGTCAACAGCCAGCAAATAGATCTGGATCTCGTAAG
CCAAATGAGGCGTTTCGAGGAGGAAGTCGACTCGGATGCAAGCTTTCTAG
ACCAT

BO29915.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-RB 324 CG32856-PB 1..321 17..337 1605 100 Plus
CG32856-RA 324 CG32856-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-RB 620 CG32856-RB 168..488 17..337 1605 100 Plus
CG32856-RA 563 CG32856-RA 168..488 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15964810..15965021 337..126 1060 100 Minus
3R 32079331 3R 15965071..15965184 130..17 570 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:46:21 has no hits.

BO29915.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:40 Download gff for BO29915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RB 168..488 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:17 Download gff for BO29915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 168..488 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:56:52 Download gff for BO29915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 168..488 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:56:52 Download gff for BO29915.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15965074..15965184 17..127 100   Minus
3R 15964808..15965019 128..339 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:17 Download gff for BO29915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11790796..11790906 17..127 100   Minus
arm_3R 11790530..11790741 128..339 99 <- Minus

BO29915.pep Sequence

Translation from 16 to 355

> BO29915.pep
MLQTNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQ
QNPKTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRF
EEEVDSDASFLDH

BO29915.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-PB 107 CG32856-PB 1..107 1..107 531 100 Plus
CG32856-PA 107 CG32856-PA 1..107 1..107 531 100 Plus