Clone BO29919 Report

Search the DGRC for BO29919

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:299
Well:19
Vector:pDNR-Dual
Associated Gene/Transcriptmsopa-RA
Protein status:BO29919.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO29919.complete Sequence

283 bp assembled on 2012-04-24

GenBank Submission: KX795982

> BO29919.complete
GAAGTTATCAGTCGACATGAACTTCATACAGATCGCCGTGCTGTTCGTCC
TGGTCGCAGTGGCCTTGGCCAGACCACAGGAAGATCCGGCAAATCTGCCA
GCTCCAGAGGCAGCAGCAGCACCACCAGCAGCAGCAGCAGCACCACCAGC
AGCAGCAGCAGCACCACCAGCACCACCAGCACCACCAGCTGCAGCACCTC
AAGCCGCTCCAGCGGGTGGTTCCGGTAGAAAGAAAAATGTCAATCACAAC
GTCATAACCATTGGAGCAAGCTTTCTAGACCAT

BO29919.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-RB 252 CG14560-PB 1..249 17..265 1245 100 Plus
msopa-RA 252 CG14560-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-RB 648 CG14560-RB 109..362 12..265 1255 99.6 Plus
msopa-RA 377 CG14560-RA 21..274 12..265 1255 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22082828..22083081 12..265 1255 99.6 Plus
Blast to na_te.dros performed on 2014-11-28 04:46:41 has no hits.

BO29919.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:42 Download gff for BO29919.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..274 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:23 Download gff for BO29919.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..274 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:57:03 Download gff for BO29919.complete
Subject Subject Range Query Range Percent Splice Strand
msopa-RA 26..274 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:57:03 Download gff for BO29919.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22082833..22083081 17..267 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:23 Download gff for BO29919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22075933..22076181 17..267 99   Plus

BO29919.pep Sequence

Translation from 16 to 283

> BO29919.pep
MNFIQIAVLFVLVAVALARPQEDPANLPAPEAAAAPPAAAAAPPAAAAAP
PAPPAPPAAAPQAAPAGGSGRKKNVNHNVITIGASFLDH

BO29919.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
msopa-PB 83 CG14560-PB 1..83 1..83 419 100 Plus
msopa-PA 83 CG14560-PA 1..83 1..83 419 100 Plus