BO29919.complete Sequence
283 bp assembled on 2012-04-24
GenBank Submission: KX795982
> BO29919.complete
GAAGTTATCAGTCGACATGAACTTCATACAGATCGCCGTGCTGTTCGTCC
TGGTCGCAGTGGCCTTGGCCAGACCACAGGAAGATCCGGCAAATCTGCCA
GCTCCAGAGGCAGCAGCAGCACCACCAGCAGCAGCAGCAGCACCACCAGC
AGCAGCAGCAGCACCACCAGCACCACCAGCACCACCAGCTGCAGCACCTC
AAGCCGCTCCAGCGGGTGGTTCCGGTAGAAAGAAAAATGTCAATCACAAC
GTCATAACCATTGGAGCAAGCTTTCTAGACCAT
BO29919.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-RB | 252 | CG14560-PB | 1..249 | 17..265 | 1245 | 100 | Plus |
msopa-RA | 252 | CG14560-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:46:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-RB | 648 | CG14560-RB | 109..362 | 12..265 | 1255 | 99.6 | Plus |
msopa-RA | 377 | CG14560-RA | 21..274 | 12..265 | 1255 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:46:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22082828..22083081 | 12..265 | 1255 | 99.6 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:46:41 has no hits.
BO29919.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:42 Download gff for
BO29919.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..274 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:23 Download gff for
BO29919.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..274 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:57:03 Download gff for
BO29919.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
msopa-RA | 26..274 | 17..267 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:57:03 Download gff for
BO29919.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22082833..22083081 | 17..267 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:23 Download gff for
BO29919.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22075933..22076181 | 17..267 | 99 | | Plus |
BO29919.pep Sequence
Translation from 16 to 283
> BO29919.pep
MNFIQIAVLFVLVAVALARPQEDPANLPAPEAAAAPPAAAAAPPAAAAAP
PAPPAPPAAAPQAAPAGGSGRKKNVNHNVITIGASFLDH
BO29919.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:12:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
msopa-PB | 83 | CG14560-PB | 1..83 | 1..83 | 419 | 100 | Plus |
msopa-PA | 83 | CG14560-PA | 1..83 | 1..83 | 419 | 100 | Plus |