Clone BO29964 Report

Search the DGRC for BO29964

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:299
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptBG642167-RA
Protein status:BO29964.pep: Imported from assembly
Sequenced Size:352

Clone Sequence Records

BO29964.complete Sequence

352 bp assembled on 2011-09-15

GenBank Submission: KX800042

> BO29964.complete
GAAGTTATCAGTCGACATGTCGTTAGCTGTATTGACTTTTCTAGTACTCT
GTGGATTTTCCTTTCAGCATCAGGCAGTTGCTGACTGCGGCGCAGAAACA
TCCGATCTCTGGAAGGATGATACGGATTCGGACGAAGGAACTTGCACTCA
AGCCTCGATAAATAATGATAGGAAGGAAGATCCATTTGAAAATGATCCAA
TTATAAGGCAATCGAAAAAGAAAGTGGAAAACAATGACAGCATGAATTCA
GAAGTTCAGTTGCCACTATTTCAGAATATAATAAAGATATTCAAGTTTAT
ATGGCTGGTGCTGAGTGTTTGGATGAATTGGAAGGCAAGCTTTCTAGACC
AT

BO29964.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-RA 321 CG34103-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-RA 384 CG34103-RA 22..340 16..334 1595 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25806663..25806917 80..334 1275 100 Plus
3R 32079331 3R 25806466..25806530 16..80 325 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:42:21 has no hits.

BO29964.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-15 17:23:17 Download gff for BO29964.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 1..318 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:20:52 Download gff for BO29964.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 1..318 17..336 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:15:33 Download gff for BO29964.complete
Subject Subject Range Query Range Percent Splice Strand
BG642167-RA 23..340 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:33 Download gff for BO29964.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25806467..25806530 17..80 100 -> Plus
3R 25806664..25806917 81..336 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:20:52 Download gff for BO29964.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21632189..21632252 17..80 100 -> Plus
arm_3R 21632386..21632639 81..336 99   Plus

BO29964.pep Sequence

Translation from 16 to 352

> BO29964.pep
MSLAVLTFLVLCGFSFQHQAVADCGAETSDLWKDDTDSDEGTCTQASINN
DRKEDPFENDPIIRQSKKKVENNDSMNSEVQLPLFQNIIKIFKFIWLVLS
VWMNWKASFLDH

BO29964.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
BG642167-PA 106 CG34103-PA 1..106 1..106 566 100 Plus