BO29996.complete Sequence
307 bp assembled on 2011-09-15
GenBank Submission: KX798399
> BO29996.complete
GAAGTTATCAGTCGACATGCTGTTCAAAATATCGTGTCTCCTCATTCTTT
TGGTCTTCTGTCTGCAGCAGAGTTATTCGATCAAACGCAGATGCCTTCAG
CCACTGGATGTGGGCAAAGGCAAGGCCTATCTGCGCAATTGGTTCTACAA
CTCCACATCGCAGAGGTGCCAAAGGTTCATCTTCTATGGAGGCGCGAGCA
ATGGCAACAACTTCAATACCCAAGCTCGATGTCACAAAATTTGCCTAGCC
CAAGTCTCTTTGCCAATTAATTTCAACTCCACTGCCGCTGCAAGCTTTCT
AGACCAT
BO29996.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:43:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-RB | 276 | CG34276-PB | 1..273 | 17..289 | 1365 | 100 | Plus |
| CG34276-RA | 276 | CG34276-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:43:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-RB | 1819 | CG34276-RB | 550..823 | 16..289 | 1370 | 100 | Plus |
| CG34276-RA | 442 | CG34276-RA | 22..295 | 16..289 | 1370 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:43:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15926373..15926581 | 81..289 | 1045 | 100 | Plus |
| 3R | 32079331 | 3R | 15926238..15926302 | 16..80 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:43:20 has no hits.
BO29996.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-15 17:34:26 Download gff for
BO29996.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 135..407 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:15 Download gff for
BO29996.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 160..432 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:15:51 Download gff for
BO29996.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34276-RA | 23..295 | 17..291 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:51 Download gff for
BO29996.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15926239..15926302 | 17..80 | 100 | -> | Plus |
| 3R | 15926373..15926581 | 81..291 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:15 Download gff for
BO29996.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11751961..11752024 | 17..80 | 100 | -> | Plus |
| arm_3R | 11752095..11752303 | 81..291 | 99 | | Plus |
BO29996.pep Sequence
Translation from 16 to 307
> BO29996.pep
MLFKISCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQR
CQRFIFYGGASNGNNFNTQARCHKICLAQVSLPINFNSTAAASFLDH
BO29996.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:19:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34276-PB | 91 | CG34276-PB | 1..91 | 1..91 | 487 | 100 | Plus |
| CG34276-PA | 91 | CG34276-PA | 1..91 | 1..91 | 487 | 100 | Plus |
