Clone BO30021 Report

Search the DGRC for BO30021

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:300
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptAcp70A-RA
Protein status:BO30021.pep: Imported from assembly
Sequenced Size:199

Clone Sequence Records

BO30021.complete Sequence

199 bp assembled on 2012-04-24

GenBank Submission: KX795756

> BO30021.complete
GAAGTTATCAGTCGACATGAAAACTCTAGCTCTATTCTTGGTTCTCGTTT
GCGTACTCGGCTTGGTCCAGGCCTGGGAATGGCCGTGGAATAGGAAGCCT
ACAAAGTTTCCAATTCCAAGCCCCAATCCTCGTGATAAGTGGTGCCGTCT
TAATTTGGGGCCCGCCTGGGGTGGAAGATGTGCAAGCTTTCTAGACCAT

BO30021.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
SP-RA 168 CG17673-PA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
SP-RA 223 CG17673-RA 4..168 17..181 825 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13301638..13301754 17..133 585 100 Plus
3L 28110227 3L 13301818..13301867 132..181 250 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:50:37 has no hits.

BO30021.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:57 Download gff for BO30021.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 4..168 17..183 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:11 Download gff for BO30021.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 4..168 17..183 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:58:48 Download gff for BO30021.complete
Subject Subject Range Query Range Percent Splice Strand
SP-RA 4..168 17..183 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:58:48 Download gff for BO30021.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13301638..13301752 17..131 100 -> Plus
3L 13301818..13301867 132..183 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:11 Download gff for BO30021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13294738..13294852 17..131 100 -> Plus
arm_3L 13294918..13294967 132..183 96   Plus

BO30021.pep Sequence

Translation from 16 to 199

> BO30021.pep
MKTLALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPA
WGGRCASFLDH

BO30021.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
SP-PA 55 CG17673-PA 1..55 1..55 324 100 Plus