BO30021.complete Sequence
199 bp assembled on 2012-04-24
GenBank Submission: KX795756
> BO30021.complete
GAAGTTATCAGTCGACATGAAAACTCTAGCTCTATTCTTGGTTCTCGTTT
GCGTACTCGGCTTGGTCCAGGCCTGGGAATGGCCGTGGAATAGGAAGCCT
ACAAAGTTTCCAATTCCAAGCCCCAATCCTCGTGATAAGTGGTGCCGTCT
TAATTTGGGGCCCGCCTGGGGTGGAAGATGTGCAAGCTTTCTAGACCAT
BO30021.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:50:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-RA | 168 | CG17673-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:50:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-RA | 223 | CG17673-RA | 4..168 | 17..181 | 825 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:50:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13301638..13301754 | 17..133 | 585 | 100 | Plus |
3L | 28110227 | 3L | 13301818..13301867 | 132..181 | 250 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:50:37 has no hits.
BO30021.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:00:57 Download gff for
BO30021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 4..168 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:11 Download gff for
BO30021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 4..168 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:58:48 Download gff for
BO30021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SP-RA | 4..168 | 17..183 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:58:48 Download gff for
BO30021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13301638..13301752 | 17..131 | 100 | -> | Plus |
3L | 13301818..13301867 | 132..183 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:11 Download gff for
BO30021.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13294738..13294852 | 17..131 | 100 | -> | Plus |
arm_3L | 13294918..13294967 | 132..183 | 96 | | Plus |
BO30021.pep Sequence
Translation from 16 to 199
> BO30021.pep
MKTLALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPA
WGGRCASFLDH
BO30021.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-PA | 55 | CG17673-PA | 1..55 | 1..55 | 324 | 100 | Plus |