Clone BO30065 Report

Search the DGRC for BO30065

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:300
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG42500-RA
Protein status:BO30065.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO30065.complete Sequence

262 bp assembled on 2011-09-15

GenBank Submission: KX799379

> BO30065.complete
GAAGTTATCAGTCGACATGAAGTTCTTTGCTCTGTGTGCCTTCCTCCTCA
TTGCCCTGGCTACCGTCCAGGCAACTCCCGGTGATCTGCGCCATGTTCCT
GTAGGACACGGAGGACACCCAGTCAATGCTGGCCACGGACCTGTGGGACA
CGCTGGTCCTGTTGGACACGGTCCAGTTGTAGGCCATGGTCCAGTTGTAG
GCCATGGTCCAGTTGTGGGACATGGTGTTCATGGTCATTCTGGCGCAAGC
TTTCTAGACCAT

BO30065.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-RB 231 CG42500-PB 1..228 17..244 1140 100 Plus
CG42500-RA 231 CG42500-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-RB 440 CG42500-RB 99..326 17..244 1140 100 Plus
CG42500-RA 344 CG42500-RA 3..230 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14152325..14152552 244..17 1140 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:37:25 has no hits.

BO30065.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-15 17:23:07 Download gff for BO30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..230 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:12 Download gff for BO30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..230 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:14:06 Download gff for BO30065.complete
Subject Subject Range Query Range Percent Splice Strand
CG42500-RA 3..230 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:14:06 Download gff for BO30065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14152322..14152552 17..246 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:12 Download gff for BO30065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9978044..9978274 17..246 99   Minus

BO30065.pep Sequence

Translation from 16 to 262

> BO30065.pep
MKFFALCAFLLIALATVQATPGDLRHVPVGHGGHPVNAGHGPVGHAGPVG
HGPVVGHGPVVGHGPVVGHGVHGHSGASFLDH

BO30065.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42500-PB 76 CG42500-PB 1..76 1..76 429 100 Plus
CG42500-PA 76 CG42500-PA 1..76 1..76 429 100 Plus