Clone BO30196 Report

Search the DGRC for BO30196

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:301
Well:96
Vector:pDNR-Dual
Associated Gene/Transcriptcib-RC
Protein status:BO30196.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO30196.complete Sequence

325 bp assembled on 2011-09-12

GenBank Submission: KX795984

> BO30196.complete
GAAGTTATCAGTCGACATGGCCGCCCCAGCACCAGCACTCAAGGATCTGC
CCAAGGTGGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGAC
AAACTGAAGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGA
AGATGTGGCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCG
CTTTCAATCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCG
TTGCCCGATAAGGAAGGAGAAGGAGAAGAATCAGTTCATCGCCGGCATCG
AGAACTTGCAAGCTTTCTAGACCAT

BO30196.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RC 294 CG4944-PC 1..291 17..307 1455 100 Plus
cib-RE 390 CG4944-PE 1..302 17..307 1310 96.4 Plus
cib-RD 390 CG4944-PD 1..302 17..307 1310 96.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RC 885 CG4944-RC 162..452 17..307 1455 100 Plus
cib-RE 911 CG4944-RE 177..478 17..307 1310 96.4 Plus
cib-RD 1502 CG4944-RD 423..724 17..307 1310 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4109689..4109824 17..152 680 100 Plus
X 23542271 X 4109895..4110011 151..267 585 100 Plus
X 23542271 X 4110161..4110203 265..307 215 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:11:51 has no hits.

BO30196.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:52:40 Download gff for BO30196.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 160..450 17..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:26 Download gff for BO30196.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 162..452 17..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:29 Download gff for BO30196.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RC 162..452 17..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:29 Download gff for BO30196.complete
Subject Subject Range Query Range Percent Splice Strand
X 4109689..4109824 17..152 100 -> Plus
X 4109897..4110010 153..266 100 -> Plus
X 4110163..4110203 267..309 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:26 Download gff for BO30196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003722..4003857 17..152 100 -> Plus
arm_X 4003930..4004043 153..266 100 -> Plus
arm_X 4004196..4004236 267..309 95   Plus

BO30196.pep Sequence

Translation from 16 to 325

> BO30196.pep
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEGEGEESVHRRHRELASF
LDH

BO30196.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PC 97 CG4944-PC 1..97 1..97 495 100 Plus
cib-PE 129 CG4944-PE 1..88 1..88 422 95.5 Plus
cib-PD 129 CG4944-PD 1..88 1..88 422 95.5 Plus
cib-PB 129 CG4944-PB 1..88 1..88 422 95.5 Plus
cib-PA 129 CG4944-PA 1..88 1..88 422 95.5 Plus