Clone BO30295 Report

Search the DGRC for BO30295

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:302
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG32643-RA
Protein status:BO30295.pep: Imported from assembly
Sequenced Size:337

Clone Sequence Records

BO30295.complete Sequence

337 bp assembled on 2011-09-12

GenBank Submission: KX798736

> BO30295.complete
GAAGTTATCAGTTGACATGTCCAGCCAGCAAAAACCCATCAATGTTTACG
TGCCGCCGATCAGCAGTTTTCCCGAAGCCAGTTTCCTGGGTGGCTATGGA
CTGCAGGATCGCATTGAGGTGCCCAAGAGCGCGGAAGTCCTTGAGGATGT
CATCGATGAGCGGGACGCGCACTTCCTCTACGTAGTCGATAGCCAGGGAC
GCCTGTTGGAGCACATACGTTACTACGGGGACGATTACCGGATGGCTTTG
CGTGAGGCCTTCACCACGAAAGTCCTTGACCAACAGAATACTGGCGCAGA
TCTCCCATTGAATCGGGAAGCAAGCTTTCTAGACCAT

BO30295.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 306 CG32643-PA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-RA 548 CG32643-RA 87..390 16..319 1520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12984610..12984913 16..319 1520 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:40:16 has no hits.

BO30295.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-12 10:53:03 Download gff for BO30295.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 55..357 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:19 Download gff for BO30295.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 88..390 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:21 Download gff for BO30295.complete
Subject Subject Range Query Range Percent Splice Strand
CG32643-RA 88..390 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:21 Download gff for BO30295.complete
Subject Subject Range Query Range Percent Splice Strand
X 12984611..12984913 17..321 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:19 Download gff for BO30295.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12878644..12878946 17..321 99   Plus

BO30295.pep Sequence

Translation from 16 to 337

> BO30295.pep
MSSQQKPINVYVPPISSFPEASFLGGYGLQDRIEVPKSAEVLEDVIDERD
AHFLYVVDSQGRLLEHIRYYGDDYRMALREAFTTKVLDQQNTGADLPLNR
EASFLDH

BO30295.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32643-PA 101 CG32643-PA 1..101 1..101 521 100 Plus