Clone BO30311 Report

Search the DGRC for BO30311

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG42810-RA
Protein status:BO30311.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO30311.complete Sequence

361 bp assembled on 2011-09-22

GenBank Submission: KX797668

> BO30311.complete
GAAGTTATCAGTCGACATGTTTCCCACCTATTCGATCAATGATGTCGCCG
CCAATGAGGAAGTAGATCATACCCAGCAAGACTTATCTTCAAAAGTCGAA
GCCGATATGCAGTCGATCATTCGTTTGGCCTACCAGGAGAACGAGGCTCT
GATCCACCAAAAAGTTATGAGCGCGATGAAGCAACGCGAAGAGGAGTTGG
CCAAGCTGTGGGATATTCGATCATCATTATCAAGCTTAGCGCAGATCAGG
GCTGCTCGTGATGAGGAACTAAGAGCTCTATTGGACCAAATCGTTTCGAA
TGCGGACAGTAGCGATGAAGATGAAGAAAAGGAAGATCCCTTTGCAAGCT
TTCTAGACCAT

BO30311.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42810-RA 330 CG42810-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42810-RA 503 CG16849-RA 136..462 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13459816..13460142 17..343 1635 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:00:38 has no hits.

BO30311.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:37 Download gff for BO30311.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 50..370 23..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:53 Download gff for BO30311.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 50..370 23..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:13 Download gff for BO30311.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 142..462 23..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:13 Download gff for BO30311.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13459822..13460142 23..345 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:53 Download gff for BO30311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13459822..13460142 23..345 99   Plus

BO30311.pep Sequence

Translation from 16 to 361

> BO30311.pep
MFPTYSINDVAANEEVDHTQQDLSSKVEADMQSIIRLAYQENEALIHQKV
MSAMKQREEELAKLWDIRSSLSSLAQIRAARDEELRALLDQIVSNADSSD
EDEEKEDPFASFLDH

BO30311.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42810-PA 109 CG16849-PA 1..109 1..109 536 100 Plus