Clone BO30312 Report

Search the DGRC for BO30312

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG42758-RA
Protein status:BO30312.pep: Imported from assembly
Sequenced Size:406

Clone Sequence Records

BO30312.complete Sequence

406 bp assembled on 2011-09-22

GenBank Submission: KX794036

> BO30312.complete
GAAGTTATCAGTCGACATGTGCATGCAAGTTCCACGGTTTGGATGTCGAG
TTCCAGTTTCCAGTTCCCGTTGTAAGACCGGTGCAACCAGATCTTGTCGA
AAGCCCGGATCTCGCTACAGAACCTTCTGCACTCCACCACCTCGCTGTAG
TCCCAGATCCTGCTGCACATCCGAATCCTGCTGCAAATCCGGGTCCTGCT
GCGGACCATGTGGGTCATGCTCGAATGGCTGTGCCGCCTGCTTATCCTCC
TGCTGTGGGATATTCCCCGAAACCTGCTGTGGTCCGTGGTGTGAGTCCTG
TCTGGATCCTTCCTGGTTCTCATGGCTGGCTCCCGATCTCGGGCGATCCT
GCTGTTGTGCTTGCATGACCTGTTGTCGATCCAAGTGCGCAAGCTTTCTA
GACCAT

BO30312.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-RA 375 CG42758-PA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-RA 631 CG42758-RA 180..552 16..388 1865 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14567682..14568054 16..388 1865 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:01:54 has no hits.

BO30312.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:38 Download gff for BO30312.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..552 17..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:59 Download gff for BO30312.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..552 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:38 Download gff for BO30312.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 181..552 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:38 Download gff for BO30312.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14567683..14568054 17..390 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:59 Download gff for BO30312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14560783..14561154 17..390 99   Plus

BO30312.pep Sequence

Translation from 16 to 406

> BO30312.pep
MCMQVPRFGCRVPVSSSRCKTGATRSCRKPGSRYRTFCTPPPRCSPRSCC
TSESCCKSGSCCGPCGSCSNGCAACLSSCCGIFPETCCGPWCESCLDPSW
FSWLAPDLGRSCCCACMTCCRSKCASFLDH

BO30312.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-PA 124 CG42758-PA 1..124 1..124 764 100 Plus
Pif2-PA 118 CG31483-PA 2..69 44..124 160 42 Plus
Pif2-PA 118 CG31483-PA 18..117 38..124 137 35 Plus