Clone BO30328 Report

Search the DGRC for BO30328

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG15283-RB
Protein status:BO30328.pep: Imported from assembly
Sequenced Size:412

Clone Sequence Records

BO30328.complete Sequence

412 bp assembled on 2011-09-22

GenBank Submission: KX799657

> BO30328.complete
GAAGTTATCAGTCGACATGATTAGATCCTGTCGAGCTCTGATCTCCCAGT
GCGGATTACACCTAAGACGATGTTCTCTTGCAAAGGCAGCAAGTAATTTG
AAAAAAGATGATGTCGAAGAAATGGAAACACCAGCGAATAGACAGAGGGT
TGAGCTGCCACCGAATCCCGAGGAAAAACTAAGTAAGCGCTATCTTGCGT
TCCGGGAAAAGCTGCGATCGGAGGCGCCGCTAGAACCACTGCCCGAGTGT
GCACCACATCCGGCCCACGAAAAGGAGCCACTTAAACCGTGGCCCAATAA
TACCAATCCGTATACCGGGGAAATCGGTGGACAAGCGGGACCAGAACCCA
CGCGCTATGGCGACTGGGAGCGCAAGGGACGAGTCACGGATTTCGCAAGC
TTTCTAGACCAT

BO30328.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-RB 381 CG15283-PB 1..378 17..394 1890 100 Plus
Sirup-RC 357 CG7224-PC 216..354 256..394 335 82.7 Plus
Sirup-RA 357 CG7224-PA 216..354 256..394 335 82.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-RB 641 CG15283-RB 63..440 17..394 1890 100 Plus
Sirup-RC 727 CG7224-RC 460..598 256..394 335 82.7 Plus
Sirup-RA 650 CG7224-RA 383..521 256..394 335 82.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14450483..14450860 394..17 1890 100 Minus
2L 23513712 2L 7999409..7999547 256..394 335 82.7 Plus
Blast to na_te.dros performed on 2014-11-27 13:56:13 has no hits.

BO30328.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:13 Download gff for BO30328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..440 17..396 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:36:04 Download gff for BO30328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..440 17..396 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:14 Download gff for BO30328.complete
Subject Subject Range Query Range Percent Splice Strand
CG15283-RB 63..440 17..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:14 Download gff for BO30328.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14450480..14450860 17..396 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:36:04 Download gff for BO30328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14450480..14450860 17..396 99   Minus

BO30328.pep Sequence

Translation from 16 to 412

> BO30328.pep
MIRSCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPN
PEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYT
GEIGGQAGPEPTRYGDWERKGRVTDFASFLDH

BO30328.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15283-PB 126 CG15283-PB 1..126 1..126 688 100 Plus
Sirup-PC 118 CG7224-PC 48..118 56..126 289 70.4 Plus
Sirup-PA 118 CG7224-PA 48..118 56..126 289 70.4 Plus