Clone BO30338 Report

Search the DGRC for BO30338

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCp7Fb-RB
Protein status:BO30338.pep: Imported from assembly
Sequenced Size:451

Clone Sequence Records

BO30338.complete Sequence

451 bp assembled on 2011-09-22

GenBank Submission: KX795438

> BO30338.complete
GAAGTTATCAGTCGACATGCGATACTCCATGGCAATGATCCCGATTCTGG
GCCTGCTGCTCGTAGCACTGATCCACGCCGCTCCCGTTGAGGTCGTCTAC
ACGGGCGAAAGTTGCGCCTGTCCCACCCAACTGGGTTACCAGCTAAATGT
GCCCAATACCCCAAAGCCAAAGAAGTATGTCGGTGGCGAGTACGGCTATC
GGGTGGAGAAGCCCGTCCAGACGAAAGCCAAGATTACCTACAGCTTTGAC
TTCACTGTGGAGCAGCCGAGGACACCGGCGCCGCCCAAGAACAATCCCGC
CAAGCTGTATGCCAAGGTGGACCGGATCACAGTCAACAAAGCGGATTGCC
AGGCCAAGAACAAGTCAACATGCGGCTGCTCGAGTTGCTCCGGCCAAAAA
CCCAGCTACGGCGAAGACGCGGGCTACGGCTACGCAAGCTTTCTAGACCA
T

BO30338.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-RB 420 CG15350-PB 1..417 17..433 2085 100 Plus
Cp7Fb-RA 1503 CG15350-PA 1..394 17..410 1955 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-RB 775 CG15350-RB 34..454 13..433 2090 99.8 Plus
Cp7Fb-RA 2093 CG15350-RA 34..431 13..410 1960 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8473870..8474201 13..344 1645 99.7 Plus
X 23542271 X 8474343..8474409 344..410 320 98.5 Plus
Blast to na_te.dros performed on 2014-11-27 13:59:03 has no hits.

BO30338.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:17 Download gff for BO30338.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 670..1086 17..435 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:37:23 Download gff for BO30338.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 38..454 17..435 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:31:16 Download gff for BO30338.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fb-RB 38..454 17..435 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:31:16 Download gff for BO30338.complete
Subject Subject Range Query Range Percent Splice Strand
X 8473874..8474201 17..344 100 -> Plus
X 8474344..8474404 345..405 100 -> Plus
X 8475723..8475750 406..435 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:37:23 Download gff for BO30338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8369756..8369783 406..435 93   Plus
arm_X 8367907..8368234 17..344 100 -> Plus
arm_X 8368377..8368437 345..405 100 -> Plus

BO30338.pep Sequence

Translation from 16 to 451

> BO30338.pep
MRYSMAMIPILGLLLVALIHAAPVEVVYTGESCACPTQLGYQLNVPNTPK
PKKYVGGEYGYRVEKPVQTKAKITYSFDFTVEQPRTPAPPKNNPAKLYAK
VDRITVNKADCQAKNKSTCGCSSCSGQKPSYGEDAGYGYASFLDH

BO30338.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fb-PB 139 CG15350-PB 1..139 1..139 749 100 Plus
Cp7Fb-PA 500 CG15350-PA 1..131 1..131 697 99.2 Plus