Clone BO30378 Report

Search the DGRC for BO30378

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG42493-RA
Protein status:BO30378.pep: Imported from assembly
Sequenced Size:496

Clone Sequence Records

BO30378.complete Sequence

496 bp assembled on 2011-09-22

GenBank Submission: KX794426

> BO30378.complete
GAAGTTATCAGTCGCCATGCATTTAAGAAAATTTTTGTATTGTTGGCCAT
TGAAATATGGCGTTATTACTGTGGGCATTGCTTTTGGACTCACGGACTTC
ATCGTGGGCAGCATTGCATGGGACATGGTTATCAGAAACAAATATCCAGA
CTATGTGGTCGAGTTCTTCAGAACCATGGACACCCGAATCTGTGTGTCCG
GATTTGCCACCGTTTTCTGGTTGATGATGACCAACCACTTTCTTTTGATC
TATGCCGTCTTTTACCACAAACTTTTGATAATCGGAACTTGGCTGTTGAT
AAACTACATGGTATTTTTGTTCACCCTTGTCACCGTGTTGTTGGATAGCT
TGCTAATCCTTAGAATAATTGCCCTCGGATACTGTTTGATCGTGGTGAAG
TCCTATTATAGTGAGTTGGCTGAGTCTCAGGAGGAATCATCCGATTCCAG
TGAGGAATCAACTAGTAGTGATAGCGATGCAAGCTTTCTAGACCAT

BO30378.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-RA 465 CG42493-PA 1..462 17..478 2310 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-RA 590 CG42493-RA 67..528 17..478 2310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11778592..11778840 17..265 1245 100 Plus
2R 25286936 2R 11779064..11779173 369..478 550 100 Plus
2R 25286936 2R 11778905..11779007 266..368 515 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:56:50 has no hits.

BO30378.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:35 Download gff for BO30378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 15..476 17..480 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:30 Download gff for BO30378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 67..528 17..480 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:07:52 Download gff for BO30378.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 67..528 17..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:07:52 Download gff for BO30378.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11778592..11778840 17..265 100 -> Plus
2R 11778905..11779007 266..368 100 -> Plus
2R 11779064..11779173 369..480 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:30 Download gff for BO30378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7666097..7666345 17..265 100 -> Plus
arm_2R 7666410..7666512 266..368 100 -> Plus
arm_2R 7666569..7666678 369..480 98   Plus

BO30378.pep Sequence

Translation from 16 to 496

> BO30378.pep
MHLRKFLYCWPLKYGVITVGIAFGLTDFIVGSIAWDMVIRNKYPDYVVEF
FRTMDTRICVSGFATVFWLMMTNHFLLIYAVFYHKLLIIGTWLLINYMVF
LFTLVTVLLDSLLILRIIALGYCLIVVKSYYSELAESQEESSDSSEESTS
SDSDASFLDH

BO30378.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-PA 154 CG42493-PA 1..154 1..154 799 100 Plus