Clone BO30385 Report

Search the DGRC for BO30385

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:303
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG43127-RC
Protein status:BO30385.pep: Imported from assembly
Sequenced Size:349

Clone Sequence Records

BO30385.complete Sequence

349 bp assembled on 2011-09-22

GenBank Submission: KX794707

> BO30385.complete
GAAGTTATCAGTCGACATGAATGCTTTGAATGCTTTTGGAATGGCCATCG
GCTGGATGGACATTGCGGGAGTTTTGTTCTTCGAAATGATAATGTTCTAT
ATGATGCGACGTCGTCGATTGGCACAAAAATCAGAAGTTGCATCGATTGA
AGCACAAGAGAAGTGCCATAGAGATTCATTGCCCAATCTCTTGACAAGGA
AAAAGCTGAGTGAAAGCGAAAACATTTGGATATTCTGGGGCTACCTGTTG
ATGCTGAATATTTGGATTGGGGTCACTCTGCTCATGATAGCTGGCATCTC
ATTTGTGGGTGAAAACAAAAACCGAAGCTTAGCAAGCTTTCTAGACCAT

BO30385.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG43127-RC 318 CG43127-PC 1..315 17..331 1560 99.7 Plus
CG43127-RD 573 CG43127-PD 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG43127-RC 698 CG43127-RC 37..351 17..331 1560 99.7 Plus
CG43127-RD 687 CG43127-RD 37..324 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10625395..10625563 185..17 845 100 Minus
3L 28110227 3L 10625206..10625335 315..186 650 100 Minus
Blast to na_te.dros performed 2014-11-27 07:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 5241..5272 103..72 106 81.2 Minus

BO30385.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:36 Download gff for BO30385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 37..351 17..333 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:47 Download gff for BO30385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 37..351 17..333 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:08:44 Download gff for BO30385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 37..351 17..333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:08:44 Download gff for BO30385.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10625206..10625335 186..315 100 <- Minus
3L 10625395..10625563 17..185 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:47 Download gff for BO30385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10618306..10618435 186..315 100 <- Minus
arm_3L 10618495..10618663 17..185 100   Minus

BO30385.pep Sequence

Translation from 16 to 349

> BO30385.pep
MNALNAFGMAIGWMDIAGVLFFEMIMFYMMRRRRLAQKSEVASIEAQEKC
HRDSLPNLLTRKKLSESENIWIFWGYLLMLNIWIGVTLLMIAGISFVGEN
KNRSLASFLDH

BO30385.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG43127-PC 105 CG42519-PA 1..105 1..105 542 100 Plus
CG43127-PD 190 CG43127-PD 1..96 1..96 497 100 Plus