Clone BO30410 Report

Search the DGRC for BO30410

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:304
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG14057-RB
Protein status:BO30410.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO30410.complete Sequence

280 bp assembled on 2012-04-24

GenBank Submission: KX795837

> BO30410.complete
GAAGTTATCAGTCGACATGGCAATCATACGCTGTCTCCATCGAGGCCAAC
GCTTCGTGTCCAGCGTATTGCCATTGATTACTTTGATCGGAGATGTACGG
GCCAAGTTTAGGACGCTGTACATTGGTGCCACCATCATCCAATGCAACAA
GTTCATAGTCAAGCACCAAAAACAGTTCCTGGACCGCACCATGGGTCAGA
TAACCTCCGCCAAGGAGCGCCAGGATCTCTTCAAGCGCGTAATGGAGTTC
GACATGGACAGAGCAAGCTTTCTAGACCAT

BO30410.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14057-RB 249 CG14057-PB 1..246 17..262 1230 100 Plus
CG14057-RA 438 CG14057-PA 190..435 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14057-RB 521 CG14057-RB 194..439 17..262 1230 100 Plus
CG14057-RA 530 CG14057-RA 203..448 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17044483..17044660 262..85 890 100 Minus
3L 28110227 3L 17044713..17044781 85..17 345 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:02:16 has no hits.

BO30410.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:01:15 Download gff for BO30410.complete
Subject Subject Range Query Range Percent Splice Strand
CG14057-RA 204..449 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:02 Download gff for BO30410.complete
Subject Subject Range Query Range Percent Splice Strand
CG14057-RA 203..448 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:02:48 Download gff for BO30410.complete
Subject Subject Range Query Range Percent Splice Strand
CG14057-RA 203..448 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:02:48 Download gff for BO30410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17044479..17044659 86..264 98 <- Minus
3L 17044713..17044781 17..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:02 Download gff for BO30410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17037579..17037759 86..264 98 <- Minus
arm_3L 17037813..17037881 17..85 100   Minus

BO30410.pep Sequence

Translation from 16 to 280

> BO30410.pep
MAIIRCLHRGQRFVSSVLPLITLIGDVRAKFRTLYIGATIIQCNKFIVKH
QKQFLDRTMGQITSAKERQDLFKRVMEFDMDRASFLDH

BO30410.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14057-PB 82 CG14057-PB 1..82 1..82 416 100 Plus
CG14057-PA 145 CG14057-PA 64..145 1..82 416 100 Plus