BO30484.complete Sequence
211 bp assembled on 2011-09-22
GenBank Submission: KX799521
> BO30484.complete
GAAGTTATCAGTCGACATGGGTTGTTGTTTTGGCAAAAGTAAATCAGTCG
ATTTGCCCGCGGTTCCGCCGGCTCCAGCCAAACAACGCTCCACTCTGCCA
GAATTCCCGATTTCTGGATCGGTGACTAGCACGGCTCCTGCAGGATCTGG
ATATGGATCTGGAGGAGCCACCAATGCGGCCCTAGAGGATGACGCAAGCT
TTCTAGACCAT
BO30484.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:42:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-RB | 180 | CG34288-PB | 1..177 | 17..193 | 870 | 99.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:42:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-RB | 436 | CG34288-RB | 48..224 | 17..193 | 870 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:42:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22446975..22447136 | 193..32 | 795 | 99.4 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:42:56 has no hits.
BO30484.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:25 Download gff for
BO30484.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 48..224 | 17..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:22 Download gff for
BO30484.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 48..224 | 17..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:03:18 Download gff for
BO30484.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 48..224 | 17..195 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:03:18 Download gff for
BO30484.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22446973..22447135 | 33..195 | 98 | <- | Minus |
3R | 22447201..22447216 | 17..32 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:22 Download gff for
BO30484.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 18272923..18272938 | 17..32 | 100 | | Minus |
arm_3R | 18272695..18272857 | 33..195 | 98 | <- | Minus |
BO30484.pep Sequence
Translation from 16 to 211
> BO30484.pep
MGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGSVTSTAPAGSGYGSGG
ATNAALEDDASFLDH
BO30484.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-PB | 59 | CG34288-PB | 1..59 | 1..59 | 310 | 100 | Plus |