Clone BO30484 Report

Search the DGRC for BO30484

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:304
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG34288-RB
Protein status:BO30484.pep: Imported from assembly
Sequenced Size:211

Clone Sequence Records

BO30484.complete Sequence

211 bp assembled on 2011-09-22

GenBank Submission: KX799521

> BO30484.complete
GAAGTTATCAGTCGACATGGGTTGTTGTTTTGGCAAAAGTAAATCAGTCG
ATTTGCCCGCGGTTCCGCCGGCTCCAGCCAAACAACGCTCCACTCTGCCA
GAATTCCCGATTTCTGGATCGGTGACTAGCACGGCTCCTGCAGGATCTGG
ATATGGATCTGGAGGAGCCACCAATGCGGCCCTAGAGGATGACGCAAGCT
TTCTAGACCAT

BO30484.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-RB 180 CG34288-PB 1..177 17..193 870 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-RB 436 CG34288-RB 48..224 17..193 870 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22446975..22447136 193..32 795 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 07:42:56 has no hits.

BO30484.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:25 Download gff for BO30484.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..224 17..195 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:22 Download gff for BO30484.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..224 17..195 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:03:18 Download gff for BO30484.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 48..224 17..195 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:03:18 Download gff for BO30484.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22446973..22447135 33..195 98 <- Minus
3R 22447201..22447216 17..32 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:22 Download gff for BO30484.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18272923..18272938 17..32 100   Minus
arm_3R 18272695..18272857 33..195 98 <- Minus

BO30484.pep Sequence

Translation from 16 to 211

> BO30484.pep
MGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGSVTSTAPAGSGYGSGG
ATNAALEDDASFLDH

BO30484.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-PB 59 CG34288-PB 1..59 1..59 310 100 Plus