Clone BO30493 Report

Search the DGRC for BO30493

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:304
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptIFa-RB
Protein status:BO30493.pep: Imported from assembly
Sequenced Size:250

Clone Sequence Records

BO30493.complete Sequence

250 bp assembled on 2011-09-22

GenBank Submission: KX797726

> BO30493.complete
GAAGTTATCAGTCGACATGGCTCTTCGATTCACACTCACTCTGCTCCTGG
TCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTAC
AGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAGA
CTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCGT
GTCCCATGTGGTTTCCCCAGAACGACAGCAAAGCAAGCTTTCTAGACCAT

BO30493.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-RB 219 CG33527-PB 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-RB 526 CG33527-RB 78..293 17..232 1080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24577934..24578066 149..17 665 100 Minus
2R 25286936 2R 24577799..24577883 232..148 425 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:44:36 has no hits.

BO30493.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:26 Download gff for BO30493.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 69..284 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:36 Download gff for BO30493.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 78..293 17..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:03:49 Download gff for BO30493.complete
Subject Subject Range Query Range Percent Splice Strand
SIFa-RB 78..293 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:03:49 Download gff for BO30493.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24577797..24577881 150..234 97 <- Minus
2R 24577934..24578066 17..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:36 Download gff for BO30493.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20465320..20465404 150..234 97 <- Minus
arm_2R 20465457..20465589 17..149 100   Minus

BO30493.pep Sequence

Translation from 16 to 250

> BO30493.pep
MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAK
MSAVCEVAMEACPMWFPQNDSKASFLDH

BO30493.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-PB 72 CG33527-PB 1..72 1..72 367 100 Plus