BO30493.complete Sequence
250 bp assembled on 2011-09-22
GenBank Submission: KX797726
> BO30493.complete
GAAGTTATCAGTCGACATGGCTCTTCGATTCACACTCACTCTGCTCCTGG
TCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTAC
AGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAGA
CTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCGT
GTCCCATGTGGTTTCCCCAGAACGACAGCAAAGCAAGCTTTCTAGACCAT
BO30493.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:44:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-RB | 219 | CG33527-PB | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:44:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-RB | 526 | CG33527-RB | 78..293 | 17..232 | 1080 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:44:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24577934..24578066 | 149..17 | 665 | 100 | Minus |
2R | 25286936 | 2R | 24577799..24577883 | 232..148 | 425 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:44:36 has no hits.
BO30493.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-22 16:35:26 Download gff for
BO30493.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IFa-RB | 69..284 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:36 Download gff for
BO30493.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IFa-RB | 78..293 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:03:49 Download gff for
BO30493.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SIFa-RB | 78..293 | 17..234 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:03:49 Download gff for
BO30493.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24577797..24577881 | 150..234 | 97 | <- | Minus |
2R | 24577934..24578066 | 17..149 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:36 Download gff for
BO30493.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20465320..20465404 | 150..234 | 97 | <- | Minus |
arm_2R | 20465457..20465589 | 17..149 | 100 | | Minus |
BO30493.pep Sequence
Translation from 16 to 250
> BO30493.pep
MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKRNSLDYDSAK
MSAVCEVAMEACPMWFPQNDSKASFLDH
BO30493.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SIFa-PB | 72 | CG33527-PB | 1..72 | 1..72 | 367 | 100 | Plus |