Clone BO30567 Report

Search the DGRC for BO30567

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:305
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptAP-1sigma-RB
Protein status:BO30567.pep: Imported from assembly
Sequenced Size:505

Clone Sequence Records

BO30567.complete Sequence

505 bp assembled on 2011-09-30

GenBank Submission: KX799689

> BO30567.complete
GAAGTTATCAGTCGACATGATGCTTTTCATGCTGCTGTTTAGTCGGCAGG
GCAAACTGCGGTTACAAAAGTGGTACATGGCCTATCCGGATAAGGTGAAA
AAGAAGATCACCCGGGAACTGGTCACTACGATACTGGCCCGCAAGCCCAA
AATGTGCTCCTTTCTGGAGTGGAAGGACTGCAAAATTGTCTACAAAAGGT
ATGCCAGCTTGTATTTCTGTTGCGCCATCGAGCAGAACGACAACGAACTG
CTGACACTGGAGATCATTCATCGCTATGTGGAGCTGTTGGATAAGTACTT
CGGCAGCGTCTGCGAGCTGGACATTATCTTTAACTTTGAAAAAGCATACT
TTATCCTGGATGAGCTGCTCATTGGCGGCGAAATCCAGGAGACGTCCAAA
AAGAACGTACTTAAGGCGATTGCCTCGCAGGATCTGCTCCAAGAGGACGA
AGCCGTTGAGGGCACTTTAAGAGACATTGGACTCCTCGCAAGCTTTCTAG
ACCAT

BO30567.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RC 474 CG5864-PC 1..471 17..487 2355 100 Plus
AP-1sigma-RB 474 CG5864-PB 1..471 17..487 2355 100 Plus
AP-1sigma-RA 474 CG5864-PA 1..431 17..447 2155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RC 795 CG5864-RC 146..616 17..487 2355 100 Plus
AP-1sigma-RB 1181 CG5864-RB 146..616 17..487 2355 100 Plus
AP-1sigma-RA 1079 CG5864-RA 146..576 17..447 2155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23959031..23959212 19..200 910 100 Plus
3R 32079331 3R 23959456..23959594 308..446 695 100 Plus
3R 32079331 3R 23959278..23959390 197..309 565 100 Plus
3R 32079331 3R 23960896..23960939 444..487 220 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:09:53 has no hits.

BO30567.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:10 Download gff for BO30567.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RB 143..613 17..489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:26:26 Download gff for BO30567.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RB 146..616 17..489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:13 Download gff for BO30567.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RB 146..616 17..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:40:13 Download gff for BO30567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23959030..23959210 17..198 99 -> Plus
3R 23959280..23959388 199..307 100 -> Plus
3R 23959456..23959593 308..445 100 -> Plus
3R 23960898..23960939 446..489 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:26:26 Download gff for BO30567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19784752..19784932 17..198 99 -> Plus
arm_3R 19785002..19785110 199..307 100 -> Plus
arm_3R 19785178..19785315 308..445 100 -> Plus
arm_3R 19786620..19786661 446..489 95   Plus

BO30567.pep Sequence

Translation from 16 to 505

> BO30567.pep
MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFL
EWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCE
LDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQEDEAVEGT
LRDIGLLASFLDH

BO30567.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-PC 157 CG5864-PC 1..157 1..157 809 100 Plus
AP-1sigma-PB 157 CG5864-PB 1..157 1..157 809 100 Plus
AP-1sigma-PA 157 CG5864-PA 1..156 1..156 761 94.9 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..145 746 99.3 Plus
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 366 46.5 Plus