Clone BO30573 Report

Search the DGRC for BO30573

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:305
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG33672-RA
Protein status:BO30573.pep: Imported from assembly
Sequenced Size:292

Clone Sequence Records

BO30573.complete Sequence

292 bp assembled on 2011-09-30

GenBank Submission: KX797709

> BO30573.complete
GAAGTTATCAGTCGACATGAGTAAATACGACTCAAAGTACCTCGAGGAGA
AGCTCAAACGGGAACTGCAGACGGAGTACGTGAGTGTTACGGACGAATCA
GACGGCTGTGGCGGCAAGTTCAGCGCCGTAATCGTATCGCCAGCCTTCAG
CGGCAAGACCCTTCTCCAGAAGCATAGATTAGTTAACTCAACGCTTGCCG
AAGAACTGAAAGAAATCCATGCATTCTCCCAGAAATCCTACACACCCGAA
GAGTGGGAGAAAGTGAAAGCCCAAGCAAGCTTTCTAGACCAT

BO30573.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-RA 261 CG33672-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-RA 1976 CG33672-RA 58..315 17..274 1290 100 Plus
CG33671-RA 1976 CG33671-RA 58..315 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12635827..12636084 274..17 1290 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:44:35 has no hits.

BO30573.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:12 Download gff for BO30573.complete
Subject Subject Range Query Range Percent Splice Strand
CG33672-RA 78..335 17..276 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:30:29 Download gff for BO30573.complete
Subject Subject Range Query Range Percent Splice Strand
CG33672-RA 58..315 17..276 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:03:31 Download gff for BO30573.complete
Subject Subject Range Query Range Percent Splice Strand
CG33671-RA 58..315 17..276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:03:31 Download gff for BO30573.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12635825..12636084 17..276 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:30:29 Download gff for BO30573.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8523330..8523589 17..276 99   Minus

BO30573.pep Sequence

Translation from 16 to 292

> BO30573.pep
MSKYDSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLL
QKHRLVNSTLAEELKEIHAFSQKSYTPEEWEKVKAQASFLDH

BO30573.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG33672-PA 86 CG33672-PA 1..86 1..86 438 100 Plus