Clone BO30594 Report

Search the DGRC for BO30594

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:305
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG42792-RA
Protein status:BO30594.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO30594.complete Sequence

298 bp assembled on 2011-09-30

GenBank Submission: KX793783

> BO30594.complete
GAAGTTATCAGTCGACATGTCTCCTAAGTTCGCACTTGCAGTTCTGCTCC
TCAGCTGCGTTCTCCTAGGACTGGCCAATGCCCAGTATAACAGGCGCTAT
CAGACTGGGCCTAACCGACAAAAAATTGGGACTCGAATGAATGCGGACGG
CCCTTTGCCGCCAAATTTCCCCCCTCCGGCTGATAATGCTGGTGGCAGTG
ATGTCCCGGCCAACGTGGATTGCATGCCCAATCTATTGGCTAGTAACACC
CTTGATACCAGGAAACCTAGGCCCAAGCATGCAAGCTTTCTAGACCAT

BO30594.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-RA 267 CG42792-PA 1..264 17..280 1320 100 Plus
CG42792-RB 267 CG42792-PB 1..264 17..280 1320 100 Plus
CG44475-RA 246 CG44475-PA 1..243 17..280 760 86.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-RA 397 CG42792-RA 7..270 17..280 1320 100 Plus
CG42792-RB 468 CG42792-RB 39..302 17..280 1320 100 Plus
CG44475-RA 343 CG44475-RA 18..260 17..280 760 86.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15865095..15865250 280..125 780 100 Minus
2L 23513712 2L 15865316..15865423 124..17 540 100 Minus
2L 23513712 2L 15882866..15882974 280..172 440 93.6 Minus
2L 23513712 2L 15883066..15883173 124..17 435 93.5 Minus
Blast to na_te.dros performed on 2014-11-27 12:50:06 has no hits.

BO30594.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:50:18 Download gff for BO30594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..264 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:01 Download gff for BO30594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 7..270 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:05:44 Download gff for BO30594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RB 39..302 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:05:44 Download gff for BO30594.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15865316..15865423 17..124 100   Minus
2L 15865093..15865250 125..282 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:01 Download gff for BO30594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15865093..15865250 125..282 98 <- Minus
arm_2L 15865316..15865423 17..124 100   Minus

BO30594.pep Sequence

Translation from 16 to 298

> BO30594.pep
MSPKFALAVLLLSCVLLGLANAQYNRRYQTGPNRQKIGTRMNADGPLPPN
FPPPADNAGGSDVPANVDCMPNLLASNTLDTRKPRPKHASFLDH

BO30594.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-PA 88 CG42792-PA 1..88 1..88 472 100 Plus
CG42792-PB 88 CG42792-PB 1..88 1..88 472 100 Plus
CG44475-PA 81 CG44475-PA 1..81 1..88 382 85.2 Plus