Clone BO30674 Report

Search the DGRC for BO30674

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:306
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG40341-RB
Protein status:BO30674.pep: Imported from assembly
Sequenced Size:346

Clone Sequence Records

BO30674.complete Sequence

346 bp assembled on 2011-09-30

GenBank Submission: KX799191

> BO30674.complete
GAAGTTATCAGTCGACATGACGACGCCGGCGACAACAGACAAGAACAACG
ACAACAACACCAGTAGCAACACCAACAACAACAGCAGCAACAAGAAGTCC
AACGAAAGCCGGCAACAACAACGTGACATGGCCAGGACAACAACAATGGC
AGCCGGAAAAGCGTCGGGAAAAATGAGGGAGGAAAATATATGGCATACAC
TTAGGCGCGCCAAGTCGCTTACTGACTTTTTGCCTATCTCGCCCGCCCGA
TTTCCCCCATTTTCCGCCTTTCCCCCCCATCCACCCCTCGGTGCACCACA
CTGGAGCGATACAGTGTGTGCATTGGCCGCAAGCTTTCTAGACCAT

BO30674.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 13:20:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 13:20:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20248223..20248423 17..217 1005 100 Plus
2L 23513712 2L 20248503..20248614 217..328 560 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:20:26 has no hits.

BO30674.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-30 10:53:22 Download gff for BO30674.complete
Subject Subject Range Query Range Percent Splice Strand
CG40341-RB 1..312 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:31:49 Download gff for BO30674.complete
Subject Subject Range Query Range Percent Splice Strand
CG40341-RB 185..496 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:12 Download gff for BO30674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20248223..20248423 17..217 100 -> Plus
2L 20248504..20248614 218..330 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:12 Download gff for BO30674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20248223..20248423 17..217 100 -> Plus
2L 20248504..20248614 218..330 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:31:49 Download gff for BO30674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20248223..20248423 17..217 100 -> Plus
arm_2L 20248504..20248614 218..330 98   Plus

BO30674.pep Sequence

Translation from 16 to 346

> BO30674.pep
MTTPATTDKNNDNNTSSNTNNNSSNKKSNESRQQQRDMARTTTMAAGKAS
GKMREENIWHTLRRAKSLTDFLPISPARFPPFSAFPPHPPLGAPHWSDTV
CALAASFLDH
Sequence BO30674.pep has no blast hits.