Clone BO30718 Report

Search the DGRC for BO30718

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:18
Vector:pDNR-Dual
Associated Gene/Transcriptvsg-RC
Protein status:BO30718.pep: Imported from assembly
Sequenced Size:583

Clone Sequence Records

BO30718.complete Sequence

583 bp assembled on 2012-03-05

GenBank Submission: KX794364

> BO30718.complete
GAAGTTATCAGTCGACATGAATCGGCAGGCGAAATTCCTAATCTTGTGCC
TCTTTGTGGGCCTCTTCTCCGCGAATTTGTGCGAAGAAGCAGTGACCACA
CCGGCTCCAGCGGACACCACCACCCAGGAATCCAAGAACACCACCACTCC
GCCGGACACCACCACTACTGTGACGCCACCGTCGACCTCAACCACGAGCA
CCACAACTGAAAAGACCACGACGACGCCACCAATTACCACATCGACTGAG
AAGACCACAACTTCCACTACTCCAGCCAGCACCACCAGCAGCACCACTCC
GGCCAGCACCACCAGCAGCACCACTCCGGCAACGACCACCACCACGCCTG
GAACTACATCTACGACCACTCCGTCTCCGAACTCGACCACAACTACGCCG
CCGCCACACACATCAACCACTCCGGCGCCGAAGCCCGTGCCGTGCGGTCA
TTTCGATGGATCCTCGTTCATTGGCGGCATTGTGCTGACTCTGGGCCTGC
TCGCTATCGGCTTAGTGGCCTACAAGTTCTACAAGGCCCGCAACGAGCGC
AACTACCACACCCTTGCAAGCTTTCTAGACCAT

BO30718.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-RC 552 CG16707-PC 1..549 17..565 2745 100 Plus
vsg-RD 552 CG16707-PD 1..549 17..565 2745 100 Plus
vsg-RE 789 CG16707-PE 1..546 17..565 2665 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-RC 2167 CG16707-RC 122..670 17..565 2745 100 Plus
vsg-RD 2273 CG16707-RD 228..776 17..565 2745 100 Plus
vsg-RE 2164 CG16707-RE 122..667 17..565 2665 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9715742..9716219 88..565 2390 100 Plus
3L 28110227 3L 9714551..9714623 17..89 365 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:08:02 has no hits.

BO30718.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:15:54 Download gff for BO30718.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RC 111..659 17..567 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:55 Download gff for BO30718.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RD 228..776 17..567 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:11:38 Download gff for BO30718.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RD 228..776 17..567 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:11:38 Download gff for BO30718.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9714551..9714623 17..89 100 -> Plus
3L 9715744..9716219 90..567 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:55 Download gff for BO30718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9707651..9707723 17..89 100 -> Plus
arm_3L 9708844..9709319 90..567 99   Plus

BO30718.pep Sequence

Translation from 16 to 583

> BO30718.pep
MNRQAKFLILCLFVGLFSANLCEEAVTTPAPADTTTQESKNTTTPPDTTT
TVTPPSTSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTS
STTPATTTTTPGTTSTTTPSPNSTTTTPPPHTSTTPAPKPVPCGHFDGSS
FIGGIVLTLGLLAIGLVAYKFYKARNERNYHTLASFLDH

BO30718.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-PC 183 CG16707-PC 1..183 1..183 954 100 Plus
vsg-PD 183 CG16707-PD 1..183 1..183 954 100 Plus
vsg-PB 182 CG16707-PB 1..182 1..183 938 99.5 Plus
vsg-PA 182 CG16707-PA 1..182 1..183 938 99.5 Plus
vsg-PE 262 CG16707-PE 1..182 1..183 938 99.5 Plus