BO30727.complete Sequence
289 bp assembled on 2012-03-05
> BO30727.complete
GAAGTTATCAGTCGACATGCCTCGCAATCAAAACGCAGAGCAGGATAATC
CCTGCCTAAAGGAACAGGAGCTTTCATTTAAATGCCTCAACAAAAACAAC
TTTGATCGCGACAAGTGCGAAATATATTTTGCCAATTATAACAATTGCAA
GGAGTTCTGGAACAAAGTAAAAACCGAAAGGAGAGCCAAGGGAATAGCTC
CTTATTTGCCGCCCTTAGAAGAACGCGATGGGATTAAAGCAGAATATATG
AAAGGAAAACCCCAACAAAGCGTAAGCTTTCTAGACCAT
BO30727.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:11:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4186-RB | 258 | CG4186-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
CG4186-RA | 258 | CG4186-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4186-RB | 444 | CG4186-RB | 56..310 | 17..271 | 1275 | 100 | Plus |
CG4186-RA | 386 | CG4186-RA | 56..310 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:10:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20769893..20770004 | 160..271 | 560 | 100 | Plus |
3L | 28110227 | 3L | 20769737..20769837 | 60..160 | 505 | 100 | Plus |
3L | 28110227 | 3L | 20769641..20769686 | 17..62 | 230 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:10:59 has no hits.
BO30727.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:15:58 Download gff for
BO30727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4186-RA | 56..311 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:19 Download gff for
BO30727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4186-RA | 56..311 | 17..273 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:12:44 Download gff for
BO30727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4186-RA | 56..311 | 17..273 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:12:44 Download gff for
BO30727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20769641..20769685 | 17..61 | 100 | -> | Plus |
3L | 20769739..20769837 | 62..160 | 100 | -> | Plus |
3L | 20769894..20770005 | 161..273 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:19 Download gff for
BO30727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20762741..20762785 | 17..61 | 100 | -> | Plus |
arm_3L | 20762839..20762937 | 62..160 | 100 | -> | Plus |
arm_3L | 20762994..20763105 | 161..273 | 99 | | Plus |
BO30727.pep Sequence
Translation from 16 to 289
> BO30727.pep
MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK
VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQSVSFLDH
BO30727.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4186-PB | 85 | CG4186-PB | 1..85 | 1..85 | 472 | 100 | Plus |
CG4186-PA | 85 | CG4186-PA | 1..85 | 1..85 | 472 | 100 | Plus |