Clone BO30729 Report

Search the DGRC for BO30729

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG4269-RA
Protein status:BO30729.pep: Imported from assembly
Sequenced Size:340

Clone Sequence Records

BO30729.complete Sequence

340 bp assembled on 2012-03-05

GenBank Submission: KX796545

> BO30729.complete
GAAGTTATCAGTCGACATGGCTAAGAATATGTTCAGCAATATATTGGTGG
TGACACTACTCGTACTCAGTTCGGATGTCGAAGCACGACCCTCCTCCTCG
GGTGTTGGTGGTGAGGCGAACGTGGATCCCAGCGAATACCACGGCAATCT
GTCGGTGGAAACGGTGCTAAAAGTGCAGCAGTGCGAGAAGGACACCAACA
CGATGGAGCTGTGCATGCGGTGCGCCAAGGTGACCAAGTCGGAATTCGTC
TATCCCATGTGCTGCGGCAACGAAGATGGCATCAAGGACTGGTGCCGGGA
GTATGTGTACTTCGGCAACGAGGCAAGCTTTCTAGACCAT

BO30729.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-RC 309 CG4269-PC 1..306 17..322 1530 100 Plus
CG4269-RA 309 CG4269-PA 1..306 17..322 1530 100 Plus
CG4269-RB 297 CG4269-PB 1..294 29..322 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-RC 898 CG4269-RC 102..407 17..322 1530 100 Plus
CG4269-RA 539 CG4269-RA 102..407 17..322 1530 100 Plus
CG4269-RB 1311 CG4269-RB 886..1179 29..322 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22599911..22600204 29..322 1470 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:13:32 has no hits.

BO30729.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:15:59 Download gff for BO30729.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 85..390 17..324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:29 Download gff for BO30729.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 102..407 17..324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:34 Download gff for BO30729.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 102..407 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:34 Download gff for BO30729.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22599911..22600204 29..324 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:29 Download gff for BO30729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18487416..18487709 29..324 99   Plus

BO30729.pep Sequence

Translation from 16 to 340

> BO30729.pep
MAKNMFSNILVVTLLVLSSDVEARPSSSGVGGEANVDPSEYHGNLSVETV
LKVQQCEKDTNTMELCMRCAKVTKSEFVYPMCCGNEDGIKDWCREYVYFG
NEASFLDH

BO30729.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-PC 102 CG4269-PC 1..102 1..102 545 100 Plus
CG4269-PA 102 CG4269-PA 1..102 1..102 545 100 Plus
CG4269-PB 98 CG4269-PB 1..98 5..102 525 100 Plus