BO30729.complete Sequence
340 bp assembled on 2012-03-05
GenBank Submission: KX796545
> BO30729.complete
GAAGTTATCAGTCGACATGGCTAAGAATATGTTCAGCAATATATTGGTGG
TGACACTACTCGTACTCAGTTCGGATGTCGAAGCACGACCCTCCTCCTCG
GGTGTTGGTGGTGAGGCGAACGTGGATCCCAGCGAATACCACGGCAATCT
GTCGGTGGAAACGGTGCTAAAAGTGCAGCAGTGCGAGAAGGACACCAACA
CGATGGAGCTGTGCATGCGGTGCGCCAAGGTGACCAAGTCGGAATTCGTC
TATCCCATGTGCTGCGGCAACGAAGATGGCATCAAGGACTGGTGCCGGGA
GTATGTGTACTTCGGCAACGAGGCAAGCTTTCTAGACCAT
BO30729.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:13:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4269-RC | 309 | CG4269-PC | 1..306 | 17..322 | 1530 | 100 | Plus |
CG4269-RA | 309 | CG4269-PA | 1..306 | 17..322 | 1530 | 100 | Plus |
CG4269-RB | 297 | CG4269-PB | 1..294 | 29..322 | 1470 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:13:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4269-RC | 898 | CG4269-RC | 102..407 | 17..322 | 1530 | 100 | Plus |
CG4269-RA | 539 | CG4269-RA | 102..407 | 17..322 | 1530 | 100 | Plus |
CG4269-RB | 1311 | CG4269-RB | 886..1179 | 29..322 | 1470 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:13:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22599911..22600204 | 29..322 | 1470 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:13:32 has no hits.
BO30729.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:15:59 Download gff for
BO30729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4269-RA | 85..390 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:29 Download gff for
BO30729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4269-RA | 102..407 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:34 Download gff for
BO30729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4269-RA | 102..407 | 17..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:34 Download gff for
BO30729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22599911..22600204 | 29..324 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:29 Download gff for
BO30729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18487416..18487709 | 29..324 | 99 | | Plus |
BO30729.pep Sequence
Translation from 16 to 340
> BO30729.pep
MAKNMFSNILVVTLLVLSSDVEARPSSSGVGGEANVDPSEYHGNLSVETV
LKVQQCEKDTNTMELCMRCAKVTKSEFVYPMCCGNEDGIKDWCREYVYFG
NEASFLDH
BO30729.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4269-PC | 102 | CG4269-PC | 1..102 | 1..102 | 545 | 100 | Plus |
CG4269-PA | 102 | CG4269-PA | 1..102 | 1..102 | 545 | 100 | Plus |
CG4269-PB | 98 | CG4269-PB | 1..98 | 5..102 | 525 | 100 | Plus |