Clone BO30731 Report

Search the DGRC for BO30731

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptEdg78E-RA
Protein status:BO30731.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO30731.complete Sequence

400 bp assembled on 2012-03-05

GenBank Submission: KX795081

> BO30731.complete
GAAGTTATCAGTCGACATGTACAAATATCTGTTCTGTCTTGCTCTCATCG
GCTGCGCCTGCGCCGACAACATCAACAAGGATGCCCAGATCCGCAGCTTC
CAGAACGACGCTACCGATGCTGAGGGCAACTACCAGTACGCCTACGAGAC
CAGCAATGGCATCCAGATCCAGGAGGCGGGCAACGCCAACGGAGCACGTG
GTGCCGTGGCTTACGTGTCGCCCGAGGGCGAGCACATCTCGCTGACATAC
ACCGCCGACGAGGAGGGCTACCATCCAGTGGGTGACCACCTGCCCACCCC
GCCCCCAGTTCCGGCTTACGTTCTCCGTGCCCTGGAATATATCCGCACCC
ATCCCCCGGCGCCCGCCCAGAAGGAGCAGCAGGCAAGCTTTCTAGACCAT

BO30731.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-RB 369 CG7673-PB 1..366 17..382 1830 100 Plus
Edg78E-RA 369 CG7673-PA 1..366 17..382 1830 100 Plus
Cpr78Cc-RA 360 CG7658-PA 107..336 114..343 250 73.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-RB 546 CG7673-RB 76..442 16..382 1835 100 Plus
Edg78E-RA 967 CG7673-RA 76..442 16..382 1835 100 Plus
Cpr78Cc-RA 522 CG7658-RA 148..377 114..343 250 73.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21297288..21297641 382..29 1770 100 Minus
3L 28110227 3L 21300797..21301026 114..343 250 73.9 Plus
Blast to na_te.dros performed 2014-11-28 08:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 588..644 220..166 108 70.2 Minus

BO30731.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:00 Download gff for BO30731.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..442 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:36 Download gff for BO30731.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..442 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:03 Download gff for BO30731.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..442 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:03 Download gff for BO30731.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21297286..21297641 29..384 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:36 Download gff for BO30731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21290386..21290741 29..384 99 <- Minus

BO30731.pep Sequence

Translation from 16 to 400

> BO30731.pep
MYKYLFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQ
IQEAGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPA
YVLRALEYIRTHPPAPAQKEQQASFLDH

BO30731.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-PB 122 CG7673-PB 1..122 1..122 658 100 Plus
Edg78E-PA 122 CG7673-PA 1..122 1..122 658 100 Plus
Cpr78Cc-PA 119 CG7658-PA 1..119 1..116 371 60.5 Plus
Cpr65Ec-PA 127 CG8634-PA 14..124 11..121 291 49.1 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 1..113 272 50 Plus