Clone BO30739 Report

Search the DGRC for BO30739

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptAdar-RC
Protein status:BO30739.pep: Imported from assembly
Sequenced Size:592

Clone Sequence Records

BO30739.complete Sequence

592 bp assembled on 2012-03-05

GenBank Submission: KX795949

> BO30739.complete
GAAGTTATCAGTCGACATGTTAAACAGCGCTAATAACAATTCTCCCCAGC
ACCCGGTGAGTGCACCATCCGATATCAACATGAATGGCTATAACCGAAAA
TTGCCACAAAAACGTGGCTATGAGATGCCAAAATACTCTGATCCAAAAAA
GAAAATGTGCAAGGAGCGCATTCCCCAGCCGAAGAACACGGTGGCCATGC
TGAATGAGCTAAGACATGGACTGATTTACAAATTGGAGTCACAGACTGGT
CCGGTACACGCACCTCTATTCACGATATCCGTGGAGGTCGATGGACAGAA
ATACTTGGGCCAGGGCCGTAGTAAAAAAGTTGCACGCATCGAAGCAGCAG
CAACTGCACTGCGCAGCTTTATACAGTTTAAGGATGGAGCAGTTCTGTCG
CCTCTGAAGCCGGCGGGCAACTTGGACTTTACCAGCGATGAACATCTTGA
AAATGGTATTGAAAATTTGTCCAGTTCAAAAATGTTTGAGATCATTCAGA
CGATGTTGACTGAAAAGCTATCCAACCCTACCTCGCTTGAACAACCCACG
TTTTGCATGAGTCAGAGCAAGTATGCAAGCTTTCTAGACCAT

BO30739.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Adar-RC 561 CG12598-PC 1..558 17..574 2790 100 Plus
Adar-RN 2010 CG12598-PN 1..550 17..566 2750 100 Plus
Adar-RD 1179 CG12598-PD 1..550 17..566 2750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Adar-RC 3451 CG12598-RC 502..1060 16..574 2795 100 Plus
Adar-RN 6823 CG12598-RN 502..1052 16..566 2755 100 Plus
Adar-RD 2042 CG12598-RD 502..1052 16..566 2755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1779088..1779377 285..574 1450 100 Plus
X 23542271 X 1778814..1778962 140..288 745 100 Plus
X 23542271 X 1778612..1778699 53..140 440 100 Plus
X 23542271 X 1775702..1775738 16..52 185 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:17:41 has no hits.

BO30739.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:03 Download gff for BO30739.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RC 483..1035 22..576 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:59 Download gff for BO30739.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RC 508..1060 22..576 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:52 Download gff for BO30739.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RC 508..1060 22..576 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:52 Download gff for BO30739.complete
Subject Subject Range Query Range Percent Splice Strand
X 1775708..1775738 22..52 100 -> Plus
X 1778612..1778699 53..140 100 -> Plus
X 1778815..1778960 141..286 100 -> Plus
X 1779090..1779377 287..576 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:59 Download gff for BO30739.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1669741..1669771 22..52 100 -> Plus
arm_X 1672645..1672732 53..140 100 -> Plus
arm_X 1672848..1672993 141..286 100 -> Plus
arm_X 1673123..1673410 287..576 99   Plus

BO30739.pep Sequence

Translation from 16 to 592

> BO30739.pep
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKE
RIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQG
RSKKVARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLENGIEN
LSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQSKYASFLDH

BO30739.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Adar-PC 186 CG12598-PC 1..186 1..186 963 100 Plus
Adar-PD 392 CG12598-PD 1..184 1..184 948 99.5 Plus
Adar-PK 392 CG12598-PK 1..184 1..184 948 99.5 Plus
Adar-PN 669 CG12598-PN 1..184 1..184 948 99.5 Plus
Adar-PM 188 CG12598-PM 15..188 13..186 898 100 Plus