Clone BO30753 Report

Search the DGRC for BO30753

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptBet5-RA
Protein status:BO30753.pep: Imported from assembly
Sequenced Size:469

Clone Sequence Records

BO30753.complete Sequence

469 bp assembled on 2012-03-05

GenBank Submission: KX796853

> BO30753.complete
GAAGTTATCAGTCGACATGACCATCTTTAACCTGTACATATTCGACAAGT
TCGGAACACTGCTCCACTACGCAGAATGGAATCGCACCAAGAAATCGGGC
ATCACACGCGAGGAAGAAGCCAAACTCACCTACGGAATGCTCTTCTCCAT
AAAGTCCTTCGTCAGTAAGATATCGCCACACGATCCCAAGGAGGGCTTCC
TTTACTACAAGACCAATCGCTACGCCCTGCATTATCTGGAAACTCCCTCT
GGATTAAAGTTCGTTCTCAACACGGACACGACGGCCATCAATGTGAAGGA
GCTGCTACAGCAGTTGTACGCCAAGGTGTGGGTAGAGTTCGTCGTGCGAG
ATCCACTGTGGACACCCGGCACGGTGGTCACCTCGGAGCTGTTCCAGTCC
AAGCTCGATGAGTTCGTCAGGCAGTCACCCATCTTCGGCATTCGCAATAT
AGCAAGCTTTCTAGACCAT

BO30753.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5-RA 438 CG1359-PA 1..435 17..451 2175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5-RA 1051 CG1359-RA 125..559 17..451 2175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30180802..30180994 259..451 965 100 Plus
3R 32079331 3R 30180509..30180653 116..260 725 100 Plus
3R 32079331 3R 30180356..30180455 17..116 500 100 Plus
Blast to na_te.dros performed 2014-11-28 08:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 2826..2855 173..202 105 83.3 Plus

BO30753.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:09 Download gff for BO30753.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 75..509 17..453 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:32 Download gff for BO30753.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 125..559 17..453 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:15:59 Download gff for BO30753.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 125..559 17..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:15:59 Download gff for BO30753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30180356..30180454 17..115 100 -> Plus
3R 30180509..30180651 116..258 100 -> Plus
3R 30180802..30180994 259..453 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:32 Download gff for BO30753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26006078..26006176 17..115 100 -> Plus
arm_3R 26006231..26006373 116..258 100 -> Plus
arm_3R 26006524..26006716 259..453 98   Plus

BO30753.pep Sequence

Translation from 16 to 469

> BO30753.pep
MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVS
KISPHDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQL
YAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFVRQSPIFGIRNIASFLD
H

BO30753.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5-PA 145 CG1359-PA 1..145 1..145 760 100 Plus