Clone BO30757 Report

Search the DGRC for BO30757

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG33259-RA
Protein status:BO30757.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO30757.complete Sequence

391 bp assembled on 2012-03-05

GenBank Submission: KX796967

> BO30757.complete
GAAGTTATCAGTCGACATGTGGAAGTGGGAAACATTCACTCTTGTGGTAC
TGTGTAGTTTTTCGGCGGTAAAGTGCTTTGCTGAGAAAGTCGATTGTTCA
GTAAATGGAACTCAAACGGATTGCCCCACAGCTTGTCCAGAAACGTGTGA
TACCAAAGGAAAGCCCAATTGTACTTTGATATGCGGAGGTCCTTGTGTCT
GCAAGCCAGGATATGTTGTCAATAGAATGATTCCTGCCTGTGTACTGCGA
TCTGATTGTCCAAAAATCGTATTACAAAGCGACAGAGCCCGAAGACTGAC
GAATTTCAATTGCTTTAGTGGGGAAAATACTTGCACTCAACTAAAACATA
GTAGTAGTAAGCGAAATAATGACGCAAGCTTTCTAGACCAT

BO30757.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-RA 360 CG33259-PA 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-RA 436 CG33259-RA 18..374 17..373 1785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15407849..15408205 17..373 1785 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:21:19 has no hits.

BO30757.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:11 Download gff for BO30757.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..357 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:42 Download gff for BO30757.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 18..374 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:11 Download gff for BO30757.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 18..374 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:11 Download gff for BO30757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15407849..15408205 17..375 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:42 Download gff for BO30757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15400949..15401305 17..375 99   Plus

BO30757.pep Sequence

Translation from 16 to 391

> BO30757.pep
MWKWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCDTKGKP
NCTLICGGPCVCKPGYVVNRMIPACVLRSDCPKIVLQSDRARRLTNFNCF
SGENTCTQLKHSSSKRNNDASFLDH

BO30757.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-PA 119 CG33259-PA 1..119 1..119 673 100 Plus
Acp62F-PA 115 CG1262-PA 31..115 24..107 301 60 Plus
CG5267-PA 178 CG5267-PA 106..169 24..88 172 50.8 Plus
CG34189-PA 122 CG34189-PA 53..112 27..87 148 44.3 Plus