Clone BO30767 Report

Search the DGRC for BO30767

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:307
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG42302-RA
Protein status:BO30767.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO30767.complete Sequence

397 bp assembled on 2012-03-05

GenBank Submission: KX797459

> BO30767.complete
GAAGTTATCAGTCGACATGGCCACGAACCAGCACGACCTCGAGCGGATTC
GCCAGCAGATCGTGTTGGCCAACATTCAGGAGCTGATAAAGAAGATGACA
CGTCGCTGCTTCGACGTATGTATCGCTATGCCGGAAATGGAGTTGCGCTC
CACGGAGCGCGACTGCCTGGCCAACTGTATGGATCGATTCATGGACTCGG
TTCAGGTGGTGTCGAGCCAGTACTTCCGTCGCCGGCGTCGCCATCAGCAA
ATTCGTTTGTCCCGTTCGACCGCCTCCTCCGCATCACCACCAGCATCCGC
ATCCGCATCCATGCCCAAATCCGCAGCAGCAAATGAATCTGAATCCGCAT
CTAGGGCCTCCAATGACGAAAAGGTCAAAGCAAGCTTTCTAGACCAT

BO30767.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-RA 366 CG42302-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-RA 759 CG42302-RA 76..438 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18725235..18725597 379..17 1815 100 Minus
Blast to na_te.dros performed on 2014-11-28 07:58:52 has no hits.

BO30767.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:15:37 Download gff for BO30767.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..363 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:25 Download gff for BO30767.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..363 17..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:08:21 Download gff for BO30767.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 76..438 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:08:21 Download gff for BO30767.complete
Subject Subject Range Query Range Percent Splice Strand
X 18725233..18725597 17..381 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:25 Download gff for BO30767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18619266..18619630 17..381 99   Minus

BO30767.pep Sequence

Translation from 16 to 397

> BO30767.pep
MATNQHDLERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDC
LANCMDRFMDSVQVVSSQYFRRRRRHQQIRLSRSTASSASPPASASASMP
KSAAANESESASRASNDEKVKASFLDH

BO30767.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-PA 121 CG42302-PA 1..121 1..121 602 100 Plus
Tim13-PA 92 CG11611-PA 12..81 8..77 185 48.6 Plus
CG34132-PA 84 CG34132-PA 12..81 8..77 175 44.3 Plus