Clone BO30826 Report

Search the DGRC for BO30826

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:308
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG16836-RA
Protein status:BO30826.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO30826.complete Sequence

262 bp assembled on 2012-03-05

GenBank Submission: KX794392

> BO30826.complete
GAAGTTATCAGTCGACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGC
TGCTTTTCTGCCTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTAT
ATCAATGGGAAATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAAT
TATAATTCCTCCAGACCATAAATCAGCTGGATCCATGTCTTACACACTCA
CATCTGGAGCCATCTTCTTTGGAATTATATATCATATATTCAGTGCAAGC
TTTCTAGACCAT

BO30826.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-RA 231 CG16836-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-RA 383 CG16836-RA 104..333 15..244 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18389229..18389393 80..244 825 100 Plus
2R 25286936 2R 18389098..18389163 15..80 330 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:23:33 has no hits.

BO30826.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:15 Download gff for BO30826.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 6..233 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:10 Download gff for BO30826.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 106..333 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:04 Download gff for BO30826.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 106..333 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:04 Download gff for BO30826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389230..18389393 81..246 98   Plus
2R 18389100..18389163 17..80 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:10 Download gff for BO30826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14276605..14276668 17..80 100 -> Plus
arm_2R 14276735..14276898 81..246 98   Plus

BO30826.pep Sequence

Translation from 16 to 262

> BO30826.pep
MKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPPD
HKSAGSMSYTLTSGAIFFGIIYHIFSASFLDH

BO30826.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-PA 76 CG16836-PA 1..76 1..76 402 100 Plus