BO30826.complete Sequence
262 bp assembled on 2012-03-05
GenBank Submission: KX794392
> BO30826.complete
GAAGTTATCAGTCGACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGC
TGCTTTTCTGCCTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTAT
ATCAATGGGAAATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAAT
TATAATTCCTCCAGACCATAAATCAGCTGGATCCATGTCTTACACACTCA
CATCTGGAGCCATCTTCTTTGGAATTATATATCATATATTCAGTGCAAGC
TTTCTAGACCAT
BO30826.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:23:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-RA | 231 | CG16836-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:23:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-RA | 383 | CG16836-RA | 104..333 | 15..244 | 1150 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:23:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18389229..18389393 | 80..244 | 825 | 100 | Plus |
2R | 25286936 | 2R | 18389098..18389163 | 15..80 | 330 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:23:33 has no hits.
BO30826.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:15 Download gff for
BO30826.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 6..233 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:10 Download gff for
BO30826.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 106..333 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:04 Download gff for
BO30826.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 106..333 | 17..246 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:04 Download gff for
BO30826.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18389230..18389393 | 81..246 | 98 | | Plus |
2R | 18389100..18389163 | 17..80 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:10 Download gff for
BO30826.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14276605..14276668 | 17..80 | 100 | -> | Plus |
arm_2R | 14276735..14276898 | 81..246 | 98 | | Plus |
BO30826.pep Sequence
Translation from 16 to 262
> BO30826.pep
MKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPPD
HKSAGSMSYTLTSGAIFFGIIYHIFSASFLDH
BO30826.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-PA | 76 | CG16836-PA | 1..76 | 1..76 | 402 | 100 | Plus |