Clone BO30861 Report

Search the DGRC for BO30861

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:308
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG16837-RA
Protein status:BO30861.pep: Imported from assembly
Sequenced Size:424

Clone Sequence Records

BO30861.complete Sequence

424 bp assembled on 2012-05-15

GenBank Submission: KX799479

> BO30861.complete
GAAGTTATCAGTCGACATGTCCAGAAGTTCGAGGTTATCAGTAACTGAAA
CTCAGCGCAAAAGCACTCCAGTGGTAAAGAAGGCGGTTATTCGCAGTCGA
TCCTACGATGGGGATGCGTTCGTCAATCTCTTCGCCCATCGCGGCGCCCG
AGACATCATGATCTTGGATAGCCATGGAGTGCCCCTCCGATCCACCTGCA
GTCAGAGACGCACCTTCGTGTTCGTCTCTAACCTGAAGCCGCTGCTCTTC
ATGGCCCGCAACGTGGTCAGGGATCTGGACCCCTCGAACGACATAACCTT
CATGCGGATTCGCTCCAATATGGGCGAAATCCACATGACCCTGGGCACGG
ACTTCATTTTGATCGTTGTGCAGAAGCTGAGGAGGCTCAGGAGCAGCTCA
ACATCAGCAAGCTTTCTAGACCAT

BO30861.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-RA 393 CG16837-PA 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-RA 576 CG16837-RA 86..475 17..406 1950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24475616..24475931 91..406 1580 100 Plus
2R 25286936 2R 24475471..24475544 17..90 370 100 Plus
Blast to na_te.dros performed 2014-11-28 11:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 7892..7962 253..183 103 60.6 Minus

BO30861.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-15 14:08:13 Download gff for BO30861.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 46..435 17..408 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:20:24 Download gff for BO30861.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 86..475 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:41:00 Download gff for BO30861.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 86..475 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:41:00 Download gff for BO30861.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24475471..24475544 17..90 100 -> Plus
2R 24475616..24475931 91..408 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:20:24 Download gff for BO30861.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20362994..20363067 17..90 100 -> Plus
arm_2R 20363139..20363454 91..408 99   Plus

BO30861.pep Sequence

Translation from 16 to 424

> BO30861.pep
MSRSSRLSVTETQRKSTPVVKKAVIRSRSYDGDAFVNLFAHRGARDIMIL
DSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRS
NMGEIHMTLGTDFILIVVQKLRRLRSSSTSASFLDH

BO30861.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-PA 130 CG16837-PA 1..130 1..130 644 100 Plus
robl-PA 97 CG10751-PA 14..93 40..119 175 42.5 Plus