Clone BO30949 Report

Search the DGRC for BO30949

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG18649-RA
Protein status:BO30949.pep: Imported from assembly
Sequenced Size:310

Clone Sequence Records

BO30949.complete Sequence

310 bp assembled on 2012-03-19

GenBank Submission: KX796559

> BO30949.complete
GAAGTTATCAGTCGACATGCGTGCCTATTTGCTGCTTGCCCTGTTTGGAT
GTGTGCTTTTGGCCACAGTTTCCGCAAATCCGGTGGACATTGACGACTTG
GAGGACCTCGAGGAGGACAAACGAATTGCTGATGAGCAGGATAATGCTAA
CGATGATGAGAAAGACGATGAGGATTCAAATGAACCCGAGTCCGACGACG
ACTTAGATGAGCCTGAATCCCCGGAGGACGATTCCCAGAACAATGATGAT
TCCGAAAGCGACGAGAGCATCCAGTACAATCAAGATGAAGAGGCAAGCTT
TCTAGACCAT

BO30949.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-RB 279 CG18649-PB 1..276 17..292 1380 100 Plus
CG18649-RA 279 CG18649-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-RB 568 CG18649-RB 33..308 17..292 1380 100 Plus
CG18649-RA 489 CG18649-RA 33..308 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15053828..15054103 292..17 1380 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:05:31 has no hits.

BO30949.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:19 Download gff for BO30949.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 31..306 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:27 Download gff for BO30949.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 33..308 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:20 Download gff for BO30949.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 33..308 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:20 Download gff for BO30949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15053824..15054103 17..294 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:27 Download gff for BO30949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15046924..15047203 17..294 99   Minus

BO30949.pep Sequence

Translation from 16 to 310

> BO30949.pep
MRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQDNANDDEKD
DEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEEASFLDH

BO30949.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-PB 92 CG18649-PB 1..92 1..92 478 100 Plus
CG18649-PA 92 CG18649-PA 1..92 1..92 478 100 Plus
l(2)01289-PG 1191 CG9432-PG 828..899 21..92 149 38.9 Plus
l(2)01289-PM 1193 CG9432-PM 828..899 21..92 149 38.9 Plus