Clone BO30952 Report

Search the DGRC for BO30952

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG42455-RA
Protein status:BO30952.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO30952.complete Sequence

268 bp assembled on 2012-03-19

GenBank Submission: KX799609

> BO30952.complete
GAAGTTATCAGTCGACATGTCCCTGCAAACGGGCTTGGCTTTCATTTTCA
CCATATTAGCCTCTGTTAGTATCGTCGCAGCAATTATTTTGTTGGGCTGG
TTCCTCATCTGGAAGGCGTTTCTATCGAAATTTCGTCTGGTTCGAGAGCT
GTTGGGTCAGGAGGAGCCGGAGGATCAGCAACCACTTGCTTGGGATCATC
AGAATCAACAGCCACACCACCACGGCAGAGCCAGGAAAGCTCGCCGAGAC
GCAAGCTTTCTAGACCAT

BO30952.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-RC 237 CG42455-PC 1..234 17..250 1170 100 Plus
CG42455-RB 237 CG42455-PB 1..234 17..250 1170 100 Plus
CG42455-RA 237 CG42455-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
vnc-RC 1137 CG11989-RC 129..362 17..250 1170 100 Plus
vnc-RD 1176 CG11989-RD 168..401 17..250 1170 100 Plus
vnc-RA 1096 CG11989-RA 88..321 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9973093..9973248 95..250 780 100 Plus
3L 28110227 3L 9972923..9973002 17..96 400 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:05:38 has no hits.

BO30952.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:20 Download gff for BO30952.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 157..390 17..252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:31 Download gff for BO30952.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RA 88..321 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:23 Download gff for BO30952.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RA 88..321 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:23 Download gff for BO30952.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972923..9973001 17..95 100 -> Plus
3L 9973094..9973248 96..252 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:31 Download gff for BO30952.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9966023..9966101 17..95 100 -> Plus
arm_3L 9966194..9966348 96..252 98   Plus

BO30952.pep Sequence

Translation from 16 to 268

> BO30952.pep
MSLQTGLAFIFTILASVSIVAAIILLGWFLIWKAFLSKFRLVRELLGQEE
PEDQQPLAWDHQNQQPHHHGRARKARRDASFLDH

BO30952.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-PC 78 CG42455-PC 1..78 1..78 407 100 Plus
CG42455-PB 78 CG42455-PB 1..78 1..78 407 100 Plus
CG42455-PA 78 CG42455-PA 1..78 1..78 407 100 Plus