BO30952.complete Sequence
268 bp assembled on 2012-03-19
GenBank Submission: KX799609
> BO30952.complete
GAAGTTATCAGTCGACATGTCCCTGCAAACGGGCTTGGCTTTCATTTTCA
CCATATTAGCCTCTGTTAGTATCGTCGCAGCAATTATTTTGTTGGGCTGG
TTCCTCATCTGGAAGGCGTTTCTATCGAAATTTCGTCTGGTTCGAGAGCT
GTTGGGTCAGGAGGAGCCGGAGGATCAGCAACCACTTGCTTGGGATCATC
AGAATCAACAGCCACACCACCACGGCAGAGCCAGGAAAGCTCGCCGAGAC
GCAAGCTTTCTAGACCAT
BO30952.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42455-RC | 237 | CG42455-PC | 1..234 | 17..250 | 1170 | 100 | Plus |
CG42455-RB | 237 | CG42455-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG42455-RA | 237 | CG42455-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
vnc-RC | 1137 | CG11989-RC | 129..362 | 17..250 | 1170 | 100 | Plus |
vnc-RD | 1176 | CG11989-RD | 168..401 | 17..250 | 1170 | 100 | Plus |
vnc-RA | 1096 | CG11989-RA | 88..321 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 9973093..9973248 | 95..250 | 780 | 100 | Plus |
3L | 28110227 | 3L | 9972923..9973002 | 17..96 | 400 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:05:38 has no hits.
BO30952.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:20 Download gff for
BO30952.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42455-RB | 157..390 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:31 Download gff for
BO30952.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
vnc-RA | 88..321 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:23 Download gff for
BO30952.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
vnc-RA | 88..321 | 17..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:23 Download gff for
BO30952.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9972923..9973001 | 17..95 | 100 | -> | Plus |
3L | 9973094..9973248 | 96..252 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:31 Download gff for
BO30952.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 9966023..9966101 | 17..95 | 100 | -> | Plus |
arm_3L | 9966194..9966348 | 96..252 | 98 | | Plus |
BO30952.pep Sequence
Translation from 16 to 268
> BO30952.pep
MSLQTGLAFIFTILASVSIVAAIILLGWFLIWKAFLSKFRLVRELLGQEE
PEDQQPLAWDHQNQQPHHHGRARKARRDASFLDH
BO30952.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42455-PC | 78 | CG42455-PC | 1..78 | 1..78 | 407 | 100 | Plus |
CG42455-PB | 78 | CG42455-PB | 1..78 | 1..78 | 407 | 100 | Plus |
CG42455-PA | 78 | CG42455-PA | 1..78 | 1..78 | 407 | 100 | Plus |