Clone BO30958 Report

Search the DGRC for BO30958

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG3262-RC
Protein status:BO30958.pep: Imported from assembly
Sequenced Size:217

Clone Sequence Records

BO30958.complete Sequence

217 bp assembled on 2012-03-19

GenBank Submission: KX796706

> BO30958.complete
GAAGTTATCAGTCGACATGGAGCGTCTATTGATCAACACGATATGGCGCT
CCTACGCAACAAAATTAACTGGGTCCCAGGTGAAGTTAATGGCGCGGGGA
TTGCCTAAAAAGCAACCGATTATTGGAGTACAAGATATTATAGTCGTTGC
CTCTGGAAAGGGTGGTGTTGGAAAAAGCACCGTGGCAGCTTGGCAAAACG
CAAGCTTTCTAGACCAT

BO30958.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RE 882 CG3262-PE 1..172 17..188 860 100 Plus
CG3262-RD 882 CG3262-PD 1..172 17..188 860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RF 900 CG3262-RF 17..199 17..199 915 100 Plus
CG3262-RE 7023 CG3262-RE 17..188 17..188 860 100 Plus
CG3262-RD 1013 CG3262-RD 17..188 17..188 860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22239932..22240103 17..188 860 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:05:19 has no hits.

BO30958.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:17 Download gff for BO30958.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RC 27..209 17..201 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:21 Download gff for BO30958.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 17..199 17..201 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:16 Download gff for BO30958.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 17..199 17..201 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:16 Download gff for BO30958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22239932..22240103 17..188 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:21 Download gff for BO30958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22239932..22240103 17..188 100   Plus

BO30958.pep Sequence

Translation from 16 to 217

> BO30958.pep
MERLLINTIWRSYATKLTGSQVKLMARGLPKKQPIIGVQDIIVVASGKGG
VGKSTVAAWQNASFLDH

BO30958.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PE 293 CG3262-PE 1..57 1..57 281 100 Plus
CG3262-PD 293 CG3262-PD 1..57 1..57 281 100 Plus