Clone BO30960 Report

Search the DGRC for BO30960

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG31864-RA
Protein status:BO30960.pep: Imported from assembly
Sequenced Size:403

Clone Sequence Records

BO30960.complete Sequence

403 bp assembled on 2012-03-19

GenBank Submission: KX794683

> BO30960.complete
GAAGTTATCAGTCGACATGCAAAAAGTGCTGGGACGCATCCAGGCGCAGG
TCCTCCGCTCCCGGGCGACGAATGCATTAGCCAATGTGGTTAGACACGAG
GCCACCTCCTCCAGGACAGCGGCTAAACCAGCCGCCACATCCAAAGAATT
CCGGGAGAGACAGGTGCGATTCAACATAAAGAACGAACAGACCGAGGGTA
GACCACTTTACCTGGATGCCCAGGCCACCACTCCAATGGACCCACGTGTA
TTGGACGCTATGCTCCCCTATCTGACCAATTTCTACGGAAATCTGGTTCG
TACGCTTCGCCTTCAACGCCTGGCAAAAGATTCTGGCCTTGGGCAATCAA
CTGGGCACAACATTTGTCTGGGAATTGGACTGCAAGCAAGCTTTCTAGAC
CAT

BO30960.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Qtzl-RC 372 CG31864-PC 1..369 17..385 1845 100 Plus
Qtzl-RA 372 CG31864-PA 1..369 17..385 1845 100 Plus
CG12264-RA 1389 CG12264-PA 1..277 17..293 1385 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Qtzl-RC 926 CG31864-RC 75..443 17..385 1845 100 Plus
Qtzl-RA 672 CG31864-RA 75..443 17..385 1845 100 Plus
CG12264-RA 1533 CG12264-RA 72..348 17..293 1385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11996000..11996240 145..385 1205 100 Plus
2L 23513712 2L 11999911..12000059 145..293 745 100 Plus
2L 23513712 2L 11999725..11999854 17..146 650 100 Plus
2L 23513712 2L 11995814..11995943 17..146 650 100 Plus
2L 23513712 2L 11992235..11992329 291..385 475 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:05:27 has no hits.

BO30960.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:18 Download gff for BO30960.complete
Subject Subject Range Query Range Percent Splice Strand
CG31864-RA 23..391 17..387 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:25 Download gff for BO30960.complete
Subject Subject Range Query Range Percent Splice Strand
Qtzl-RA 75..443 17..387 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:18 Download gff for BO30960.complete
Subject Subject Range Query Range Percent Splice Strand
Qtzl-RA 75..443 17..387 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:18 Download gff for BO30960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11995814..11995943 17..146 100 -> Plus
2L 11996002..11996240 147..387 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:25 Download gff for BO30960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11995814..11995943 17..146 100 -> Plus
arm_2L 11996002..11996240 147..387 99   Plus

BO30960.pep Sequence

Translation from 16 to 403

> BO30960.pep
MQKVLGRIQAQVLRSRATNALANVVRHEATSSRTAAKPAATSKEFRERQV
RFNIKNEQTEGRPLYLDAQATTPMDPRVLDAMLPYLTNFYGNLVRTLRLQ
RLAKDSGLGQSTGHNICLGIGLQASFLDH

BO30960.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Qtzl-PC 123 CG31864-PC 1..123 1..123 618 100 Plus
Qtzl-PA 123 CG31864-PA 1..123 1..123 618 100 Plus
CG12264-PA 462 CG12264-PA 1..92 1..92 462 100 Plus