BO30962.complete Sequence
202 bp assembled on 2012-03-19
GenBank Submission: KX795233
> BO30962.complete
GAAGTTATCAGTCGACATGAAGATGAGCTCGCCCAGGATCATGCAGCAGA
AACGGAGCAGCAAGTCCTCCAATTCGTCGCGGGTCTCCATGACCACCTCG
ACGGCGGAGGAGAATCTCATAGAATCGAAGCTCTTCAGCTGGATGCGTCT
ATTCCGATTCGCCTCGCTGCTCTGCCGCGCCGAGGCAAGCTTTCTAGACC
AT
BO30962.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-RC | 171 | CG31808-PC | 1..168 | 17..184 | 840 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-RC | 1929 | CG31808-RC | 523..690 | 17..184 | 840 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16705525..16705692 | 184..17 | 840 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:05:54 has no hits.
BO30962.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:22 Download gff for
BO30962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 519..686 | 17..186 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:37 Download gff for
BO30962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 523..690 | 17..186 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:28 Download gff for
BO30962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 523..690 | 17..186 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:28 Download gff for
BO30962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16705523..16705692 | 17..186 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:37 Download gff for
BO30962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16705523..16705692 | 17..186 | 98 | | Minus |
BO30962.pep Sequence
Translation from 16 to 202
> BO30962.pep
MKMSSPRIMQQKRSSKSSNSSRVSMTTSTAEENLIESKLFSWMRLFRFAS
LLCRAEASFLDH
BO30962.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-PC | 56 | CG31808-PC | 1..56 | 1..56 | 273 | 100 | Plus |