Clone BO30962 Report

Search the DGRC for BO30962

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG31808-RC
Protein status:BO30962.pep: Imported from assembly
Sequenced Size:202

Clone Sequence Records

BO30962.complete Sequence

202 bp assembled on 2012-03-19

GenBank Submission: KX795233

> BO30962.complete
GAAGTTATCAGTCGACATGAAGATGAGCTCGCCCAGGATCATGCAGCAGA
AACGGAGCAGCAAGTCCTCCAATTCGTCGCGGGTCTCCATGACCACCTCG
ACGGCGGAGGAGAATCTCATAGAATCGAAGCTCTTCAGCTGGATGCGTCT
ATTCCGATTCGCCTCGCTGCTCTGCCGCGCCGAGGCAAGCTTTCTAGACC
AT

BO30962.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-RC 171 CG31808-PC 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-RC 1929 CG31808-RC 523..690 17..184 840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16705525..16705692 184..17 840 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:05:54 has no hits.

BO30962.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:22 Download gff for BO30962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 519..686 17..186 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:37 Download gff for BO30962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 523..690 17..186 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:28 Download gff for BO30962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 523..690 17..186 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:28 Download gff for BO30962.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16705523..16705692 17..186 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:37 Download gff for BO30962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16705523..16705692 17..186 98   Minus

BO30962.pep Sequence

Translation from 16 to 202

> BO30962.pep
MKMSSPRIMQQKRSSKSSNSSRVSMTTSTAEENLIESKLFSWMRLFRFAS
LLCRAEASFLDH

BO30962.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-PC 56 CG31808-PC 1..56 1..56 273 100 Plus