Clone BO30986 Report

Search the DGRC for BO30986

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:309
Well:86
Vector:pDNR-Dual
Associated Gene/Transcriptkoko-RF
Protein status:BO30986.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO30986.complete Sequence

400 bp assembled on 2012-03-19

GenBank Submission: KX797822

> BO30986.complete
GAAGTTATCAGTCGACATGTCCTACGCCGGCTATAGCCAGCTGCCCAGCG
GCAGCGACCAGGAGCGCAGGCAGGCGCAGCTCGCGGCCAGCACCTACGAC
GTGCTACAGCGGACGACGGACAGTATCCAGCGATCCAACCAGATTGCCAT
CGAAACGGAGAACATGGGGGCGGAGGTACTCGGCGAACTGGGCGAGCAGA
GGGAGTCGCTGCTACGCACCACGCGCCGCCTGGAGGACGCCGATCAGGAT
CTGTCCAAATCGAGGGTCATCATTCGGAAGTTGAGCAGGGAGGTGCTCTA
CAACAAGATCATCCTAATCCTGATTATCATTCTGGAGGTGGGCATACTCG
TCGGCTTGCTGGTGCTGAAGTTCGCTCACCTGGCAAGCTTTCTAGACCAT

BO30986.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG44009-RA 369 CG44009-PA 1..366 17..382 1830 100 Plus
CG44009-RB 222 CG44009-PB 1..219 164..382 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG44009-RA 571 CG44009-RA 84..449 17..382 1830 100 Plus
CG44009-RB 977 CG44009-RB 510..855 37..382 1730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18400009..18400217 174..382 1045 100 Plus
3R 32079331 3R 18399792..18399953 17..178 810 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:06:25 has no hits.

BO30986.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 11:49:28 Download gff for BO30986.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RF 60..425 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:56 Download gff for BO30986.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 84..449 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:19:44 Download gff for BO30986.complete
Subject Subject Range Query Range Percent Splice Strand
CG44009-RA 84..449 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:19:44 Download gff for BO30986.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18399792..18399950 17..175 100 -> Plus
3R 18400011..18400217 176..384 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:56 Download gff for BO30986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14225514..14225672 17..175 100 -> Plus
arm_3R 14225733..14225939 176..384 99   Plus

BO30986.pep Sequence

Translation from 16 to 400

> BO30986.pep
MSYAGYSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENM
GAEVLGELGEQRESLLRTTRRLEDADQDLSKSRVIIRKLSREVLYNKIIL
ILIIILEVGILVGLLVLKFAHLASFLDH

BO30986.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG44009-PA 122 CG44009-PA 1..122 1..122 583 100 Plus
CG44009-PB 73 CG44009-PB 1..73 50..122 342 100 Plus