Clone BO31106 Report

Search the DGRC for BO31106

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG43054-RA
Protein status:BO31106.pep: Imported from assembly
Sequenced Size:442

Clone Sequence Records

BO31106.complete Sequence

442 bp assembled on 2012-03-19

GenBank Submission: KX796999

> BO31106.complete
GAAGTTATCAGTCGACATGAATTGGTTCAATAATATATGCGAGGAAAGTC
GCTTAAAGTTTTTTCCCAATCTTCAAACAGTCAAAGCTAAGCGTAAATAC
GAAATTGGCCTGATGAGCGCAGATGAGTGCTATAGTTTCATAAAGAAAAA
CCTGAAGTCCAGAAATGTTGTAGAAGAAGAAATGTTGTGGAAAGTCCCCA
TAATTCTTGTGTGTATCGGCTGCATAATAGTCATACTATTTGCATTTTGT
TTCGCATTTCAGTGTGTGATAACAAAGGTAAAGACCGCCAAAGTGCCAAA
GCGTTTCGATTTCGACATTTGTGAAGCTGAAAAACCAAAAGCCCAACCAA
TCCACAAGGCCAGCCAAATTGATCACCCAAAGAAAGGAACAAATTGCTGT
ACTTGTTTAAAATCAAATCTACTTGCAAGCTTTCTAGACCAT

BO31106.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43054-RA 411 CG43054-PA 1..408 17..424 2040 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG43054-RA 531 CG43054-RA 39..450 13..424 2045 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17627897..17628308 13..424 2045 99.8 Plus
Blast to na_te.dros performed on 2014-11-28 05:20:31 has no hits.

BO31106.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:51 Download gff for BO31106.complete
Subject Subject Range Query Range Percent Splice Strand
CG43054-RA 43..450 17..426 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:37:47 Download gff for BO31106.complete
Subject Subject Range Query Range Percent Splice Strand
CG43054-RA 43..450 17..426 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:08:56 Download gff for BO31106.complete
Subject Subject Range Query Range Percent Splice Strand
CG43054-RA 43..450 17..426 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:08:56 Download gff for BO31106.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17627901..17628308 17..426 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:37:47 Download gff for BO31106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17627901..17628308 17..426 99   Plus

BO31106.pep Sequence

Translation from 16 to 442

> BO31106.pep
MNWFNNICEESRLKFFPNLQTVKAKRKYEIGLMSADECYSFIKKNLKSRN
VVEEEMLWKVPIILVCIGCIIVILFAFCFAFQCVITKVKTAKVPKRFDFD
ICEAEKPKAQPIHKASQIDHPKKGTNCCTCLKSNLLASFLDH

BO31106.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG43054-PA 136 CG43054-PA 1..136 1..136 733 100 Plus