Clone BO31112 Report

Search the DGRC for BO31112

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG43069-RA
Protein status:BO31112.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO31112.complete Sequence

271 bp assembled on 2012-03-19

GenBank Submission: KX796004

> BO31112.complete
GAAGTTATCAGTCGACATGGCCAATCAAAGCAAAACCATTTGGCTTCTAT
CCTCAAATCTACCTAAACTGCGGTGCCATGTGAGAACGGATCAACCTTTG
GCCGCACTTCTTAGGCAAAAATATGCCCAGGCATTTGGAGTTGCTACTGA
GTCTCTGATCCTGGCCTTCGATGGTGAGAAAATCCAGGAGGAGGACACAT
TTGACTCCTTGGCCATGGAGGATAATGACATCGTCGATGTTGTAGAAGAA
TGTGCAAGCTTTCTAGACCAT

BO31112.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG43069-RA 240 CG43069-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43069-RA 416 CG43069-RA 25..261 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18862886..18863122 17..253 1185 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:17:47 has no hits.

BO31112.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:48 Download gff for BO31112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43069-RA 25..261 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:37:29 Download gff for BO31112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43069-RA 25..261 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:07:53 Download gff for BO31112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43069-RA 25..261 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:07:53 Download gff for BO31112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18862886..18863122 17..255 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:37:29 Download gff for BO31112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14750391..14750627 17..255 99   Plus

BO31112.pep Sequence

Translation from 16 to 271

> BO31112.pep
MANQSKTIWLLSSNLPKLRCHVRTDQPLAALLRQKYAQAFGVATESLILA
FDGEKIQEEDTFDSLAMEDNDIVDVVEECASFLDH

BO31112.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43069-PA 79 CG43069-PA 1..79 1..79 401 100 Plus