Clone BO31114 Report

Search the DGRC for BO31114

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:311
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG43072-RA
Protein status:BO31114.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO31114.complete Sequence

280 bp assembled on 2012-03-19

GenBank Submission: KX796386

> BO31114.complete
GAAGTTATCAGTCGACATGACCATGGAACTGCTTGCGCGGCACAATCTTC
AGAAGGTTGAACAGCTCACGACCTTCGATCTGAAATATTTCTTTATCATC
TACGCCATCGTCGTCCTGATGATCCTGGGTGTTCCACTGGCCTTCCTACT
TCAAAGCAAGGGTTCGGCGAACGAAAGGGATCGTTTTCAATTGGAAGCCA
ATCGATCGCGCGTGGATCCAGTGAGGGGAGAAACCCGGCGACGAATCCGG
GATTCGAGTGCCGCAAGCTTTCTAGACCAT

BO31114.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-RA 249 CG43072-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-RA 387 CG43072-RA 87..332 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21065938..21066183 17..262 1230 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:21:05 has no hits.

BO31114.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-19 10:05:53 Download gff for BO31114.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..246 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:38:00 Download gff for BO31114.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 87..332 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:09:11 Download gff for BO31114.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 87..332 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:09:11 Download gff for BO31114.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21065938..21066183 17..264 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:38:00 Download gff for BO31114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21059038..21059283 17..264 99   Plus

BO31114.pep Sequence

Translation from 16 to 280

> BO31114.pep
MTMELLARHNLQKVEQLTTFDLKYFFIIYAIVVLMILGVPLAFLLQSKGS
ANERDRFQLEANRSRVDPVRGETRRRIRDSSAASFLDH

BO31114.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-PA 82 CG43072-PA 1..82 1..82 403 100 Plus